DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and si:dkey-21e2.10

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_009294620.1 Gene:si:dkey-21e2.10 / 556860 ZFINID:ZDB-GENE-050208-778 Length:249 Species:Danio rerio


Alignment Length:264 Identity:69/264 - (26%)
Similarity:109/264 - (41%) Gaps:70/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 GRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFN-CGCAMIAPRFAITAAHCASVGGESPS 214
            |...:.:..|||.:|.:                 |..: ||.::|...|.:|||||..   |...
Zfish    27 GTEAKPHSRPYMVSLQF-----------------YKLHMCGGSLITEEFVLTAAHCWE---EDDV 71

  Fly   215 VALIGGVE------LNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLARRSHMPVACLWNQESL 273
            :.::.|..      :|:    :.::|....||.|:::||.||:.:::|..:..     |.|...|
Zfish    72 LTVVTGAHDLRKKAINN----VYKVKSYIPHPDFNSKTLENDIMLLQLKTKVR-----LSNNVGL 127

  Fly   274 PERP-----------LTALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQ-RYLHNYDKLANGLGSG 326
            ...|           .:..|:|.....||.:..|.:.....:|..:|: |:..:|      :.|.
Zfish   128 ISLPKDGEDVKADTLCSVAGWGDLWSKGPETDRLREAETVIVNNAECERRWESDY------VASK 186

  Fly   327 QMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGG--ACASGQ-PGVYVRIAHY 388
            .:|...:.|   ||.|||||||:...          .||||||||.  .|.|.. |.|:.||:.|
Zfish   187 MICVYGHGG---TCSGDSGGPLVCGD----------TVVGITSFGEPYLCNSRLFPDVHTRISAY 238

  Fly   389 IQWI 392
            :.||
Zfish   239 LPWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 69/264 (26%)
Tryp_SPc 149..392 CDD:214473 67/262 (26%)
si:dkey-21e2.10XP_009294620.1 Tryp_SPc 27..242 CDD:214473 67/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.