DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and LOC4577519

DIOPT Version :10

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_061513842.1 Gene:LOC4577519 / 4577519 VectorBaseID:AGAMI1_007013 Length:63 Species:Anopheles gambiae


Alignment Length:57 Identity:19/57 - (33%)
Similarity:25/57 - (43%) Gaps:11/57 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCA 206
            ||.....:|..:|..:||         ...|.|..|.  ||..:|..:|.:||||||
Mosquito    13 GGFRALRDEFQHMVVIGW---------TRASGKIDYL--CGGTLIIKQFVLTAAHCA 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 19/57 (33%)
LOC4577519XP_061513842.1 None

Return to query results.
Submit another query.