DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and snk

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:359 Identity:114/359 - (31%)
Similarity:172/359 - (47%) Gaps:48/359 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GKCVRYVDCISAMQAV----PRVTPLLCPSSWPNQLVCCP----HGGYLLPPPSISKSEQACANA 109
            |.|:....|:..::..    .|:.  :|.......::|||    |  .|....|.:|.::..|.|
  Fly   102 GYCILAYQCLHVIREYRVHGTRID--ICTHRNNVPVICCPLADKH--VLAQRISATKCQEYNAAA 162

  Fly   110 YPRAHHKRRRRRRNTNPKLDQVELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRW 174
                   ||....:|.......:.|        .|..|:|||..|:....|:|.||||...:   
  Fly   163 -------RRLHLTDTGRTFSGKQCV--------PSVPLIVGGTPTRHGLFPHMAALGWTQGS--- 209

  Fly   175 IHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGGVELN--SGRGQLIEIKRIS 237
                ||..:...:.||.|:::..:.:||||||:.|.:.|.:..:|..:||  |...|.|:|..|.
  Fly   210 ----GSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLGARQLNETSATQQDIKILIIV 270

  Fly   238 QHPHFDAETLTNDLAVVKLARR----SHMPVACLWNQESLPERPLTALGYGQTKFAGPHSSNLLQ 298
            .||.:.:....:|:|::||.||    ..:..||||....|....:.|.|:|:|:|.|..|:.|.|
  Fly   271 LHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIPTVVAAGWGRTEFLGAKSNALRQ 335

  Fly   299 IMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPL--LLHQHMRHHRHTI 361
            :.|..:....|::......:|..|:..||.|||...|..||||||||||:  ||.::     :.:
  Fly   336 VDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEY-----NCV 395

  Fly   362 PYVVGITSFGGACAS-GQPGVYVRIAHYIQWIEQ 394
            .:||||||||..||: ..||||.|:..|:.|||:
  Fly   396 AFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEK 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 94/255 (37%)
Tryp_SPc 149..392 CDD:214473 91/251 (36%)
snkNP_001097766.1 CLIP 93..139 CDD:197829 6/38 (16%)
Tryp_SPc 186..430 CDD:238113 94/256 (37%)
Tryp_SPc 186..427 CDD:214473 91/252 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 1 1.000 - - FOG0012732
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.