DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and CG16749

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:63/277 - (22%)
Similarity:115/277 - (41%) Gaps:77/277 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGES 212
            :|.|..:...::|::.::            .|||.   :.:||.::|:.:|.:|||||.. |.::
  Fly    30 VVNGTDSSVEKYPFVISM------------RGSSG---SHSCGGSIISKQFVMTAAHCTD-GRKA 78

  Fly   213 PSVALIGGV-ELNSGRGQLIEIKRISQHPHFDA-ETLTNDLAVVKLARRSHM------PVACLWN 269
            ..:::..|| ::|:....::.:|:|.||..::. ....||::::.:......      ||     
  Fly    79 SDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPV----- 138

  Fly   270 QESLPE----RPLT-------ALGYGQTKFAGPHSSNLLQIMLYHLNFQQC---------QRYLH 314
              .|||    .|.|       .:|:|.....|...|.|.::.|...:.::|         .||  
  Fly   139 --KLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRY-- 199

  Fly   315 NYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFG--GACASG 377
                        .:|.|...|....|.|||||||:.:...          |||.|:.  ....:.
  Fly   200 ------------HICGGVDEGGKGQCSGDSGGPLIYNGQQ----------VGIVSWSIKPCTVAP 242

  Fly   378 QPGVYVRIAHYIQWIEQ 394
            .||||.:::.|:.||::
  Fly   243 YPGVYCKVSQYVDWIKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 63/276 (23%)
Tryp_SPc 149..392 CDD:214473 61/272 (22%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 61/273 (22%)
Tryp_SPc 30..259 CDD:238113 63/275 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456074
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.