DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and CG4998

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:362 Identity:101/362 - (27%)
Similarity:153/362 - (42%) Gaps:86/362 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 YLLPPPSISKSEQACANAYPRAHHKRRRRRRNTN--------PK----------------LDQVE 132
            |.:|.|:..::..:....:|     |.||||:..        ||                :::|.
  Fly   845 YNIPTPAPGEAAGSDRITFP-----RDRRRRSVEDGVWAGAAPKEQRAYYGNRPVEKTCRINEVC 904

  Fly   133 LVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSK--------------- 182
            ...|:..:....|    .||....|      |.|...|....::..|.|:               
  Fly   905 CRRPLRPQAPPQQ----FGRCGVRN------AAGITGRIKNPVYVDGDSEFGEYPWHVAILKKDP 959

  Fly   183 RRYTFNCGCAMIAPRFAITAAHC-ASVGGESPSVALIGGVELNSGRGQLIEIKR----ISQHPHF 242
            :...:.||..:|..:..|:|||| .|..|....|.| |..::|........|:|    :..||.:
  Fly   960 KESIYACGGTLIDAQHIISAAHCIKSQNGFDLRVRL-GEWDVNHDVEFFPYIERDVVSVHIHPEY 1023

  Fly   243 DAETLTNDLAVVKL------ARRSHMPVACLWNQES--LPERPLTALGYGQTKFA--GPHSSNLL 297
            .|.||.|||||:||      .:..|:..|||.::.|  ...|..|. |:|:..|.  |.:.:.|.
  Fly  1024 YAGTLDNDLAVLKLDQPVDFTKNPHISPACLPDKYSDFTGARCWTT-GWGKDAFGEHGKYQNILK 1087

  Fly   298 QIMLYHLNFQQCQRYLHNYDKLANG--LGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHT 360
            ::.:..|:.|||:..|.| .:|...  |..|.:|||...|. |.|:||.||||:..::...|   
  Fly  1088 EVDVPILSHQQCESQLRN-TRLGYSYKLNPGFVCAGGEEGK-DACKGDGGGPLVCDRNGAMH--- 1147

  Fly   361 IPYVVGITSFGGACASGQ---PGVYVRIAHYIQWIEQ 394
               |||:.|:|..|  ||   |||||:::.|:.||:|
  Fly  1148 ---VVGVVSWGIGC--GQVNVPGVYVKVSAYLPWIQQ 1179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 87/281 (31%)
Tryp_SPc 149..392 CDD:214473 84/277 (30%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 80/250 (32%)
Tryp_SPc 942..1177 CDD:214473 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456103
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.