DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and CG3700

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:425 Identity:116/425 - (27%)
Similarity:174/425 - (40%) Gaps:106/425 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GYRLILEFVLISTLA-YAQNAPWNA--VAPSYLSIDIYGNCQAHDRPLIGKCVRYVDCISAMQAV 68
            |.:::|....:|.:. |..|.....  :.||...:..|      ::.|||..|:|.|..      
  Fly     6 GIQILLLIASVSVVTEYCDNGTGECKELTPSDCPVIFY------NQHLIGAEVKYCDEF------ 58

  Fly    69 PRVTPLLCPSSWPNQLVCCPHGGYLLPPPSISKSEQACANAYPRAHHKRRRRRRNTNPKLDQVEL 133
                         |.:||||                     .|..|       :|..| .:|...
  Fly    59 -------------NDIVCCP---------------------IPLDH-------QNLKP-AEQTRP 81

  Fly   134 VEPIIQKHN------QSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCA 192
            .|...:::|      ||...:|||......|.|:|..:|        .|....||....::||.:
  Fly    82 FEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIG--------THRPNKSKSDINWDCGGS 138

  Fly   193 MIAPRFAITAAHCASV----------GGESPS-VALIGGVELNSGRGQ-LIEIKRISQ---HPHF 242
            ::.|:|.:|||||...          ..:||. |..:|.::.||.... |::..|:..   ||.:
  Fly   139 VVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGY 203

  Fly   243 DAET----LTNDLAVVKLARRS----HMPVACLWNQESLPERPLTALGYGQTKFAGPHSSNLLQI 299
            |.|.    ..||:|:|:|.|::    |:...||........:.:||.|:|.|. .|..||:||::
  Fly   204 DTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTA-DGVKSSHLLKV 267

  Fly   300 MLYHLNFQQCQRYLH-NYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPY 363
            .|...:.:.||:.|. :.|...      |.|||..|...|||.||||||:.: ||..:  ..:..
  Fly   268 NLQRFSDEVCQKRLRFSIDTRT------QFCAGSMSSQADTCNGDSGGPIFV-QHPLY--PCLKQ 323

  Fly   364 VVGITSFGGACAS-GQPGVYVRIAHYIQWIEQQVW 397
            |:||.|:|..|.| |.|.||.::..|..|||..||
  Fly   324 VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVW 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 86/270 (32%)
Tryp_SPc 149..392 CDD:214473 83/267 (31%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 86/271 (32%)
Tryp_SPc 102..353 CDD:214473 83/268 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.