DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and CG13527

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:312 Identity:69/312 - (22%)
Similarity:121/312 - (38%) Gaps:91/312 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AHHKRRRRRRNTNPKL---DQVELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRW 174
            ||    |.:|.::||.   :.:||.:.::...:::.|...|     :|.:               
  Fly    21 AH----RMKRLSSPKFHGDETLELAKYVVSIRSRTPNKYFG-----DNHY--------------- 61

  Fly   175 IHEHGSSKRRYTFNCGCAMIAPRFAITAAHCAS--------------VGGESPSVALIGGVELNS 225
                          ||..:::.::.||||||..              |.|....:....|..:.|
  Fly    62 --------------CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCS 112

  Fly   226 GRGQLIEIKRISQHPHFDAETLTNDLAVVKLARRSHMP-----VACLWNQESLPERPL--TALGY 283
            ....|...|..:.|..|       ::|::||..:  ||     :..|...:..|:..:  |.||:
  Fly   113 PVSSLYVPKNFTMHNTF-------NMALMKLQEK--MPSNDPRIGFLHLPKEAPKIGIRHTVLGW 168

  Fly   284 GQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDT--CQGDSGG 346
            |:..|.||.:.::.|:.:..::...|:.|..:|       |.|.||||:.:..:|.  |.||.|.
  Fly   169 GRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHY-------GDGMMCAGNNNWTIDAEPCSGDIGS 226

  Fly   347 PLLLHQHMRHHRHTIPYVVGITSFGGAC-ASGQPGVYVRIAHYIQWIEQQVW 397
            |||..:          .||||.::...| .:..|.||..:...::||....:
  Fly   227 PLLSGK----------VVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHTAY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 60/269 (22%)
Tryp_SPc 149..392 CDD:214473 58/266 (22%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 61/282 (22%)
Tryp_SPc 43..263 CDD:214473 59/279 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.