DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and CG4259

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:236 Identity:48/236 - (20%)
Similarity:82/236 - (34%) Gaps:72/236 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 AMIAPRFAITAAHCASVGGESPSVALIGGVELNSGRGQL---IEIKRISQHPHFDAETLTNDLAV 253
            ::|.|...:||||..:...:...|...|..:.::...|.   :|:..|..|..|:.....|::|:
  Fly    60 SLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMAL 124

  Fly   254 VKLARRSHMPV-----------------ACLWNQESLPERPLTALGYGQTKFAGPHSSNLLQIML 301
            :.|.....|..                 :|.:|            |:|:..........:|:.: 
  Fly   125 LILVSAFEMTANINLIPLYLQEAGIQKGSCFFN------------GWGKVYLNSTDYPTVLKTV- 176

  Fly   302 YHLNFQQCQRYLHNYDKLANGLGSG------QMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHT 360
                         ..|.|:.|:.|.      |:|.....| :| |.||.|.||:.      ...|
  Fly   177 -------------QVDLLSMGMCSSRKLPIQQICGKGLEG-ID-CSGDGGAPLVC------RILT 220

  Fly   361 IPY---VVGITSFGGACASGQPG-----VYVRIAHYIQWIE 393
            .||   .|||.::    .|.:|.     |:..:|..:.||:
  Fly   221 YPYKYAQVGIVNW----LSQKPVENTFIVFTNVAGLLPWID 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 48/236 (20%)
Tryp_SPc 149..392 CDD:214473 46/233 (20%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 48/236 (20%)
Tryp_SPc 39..256 CDD:214473 46/233 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.