DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and GZMK

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:265 Identity:70/265 - (26%)
Similarity:114/265 - (43%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHC--ASVGG 210
            ::||:....:..|:|.::           ::|..     ..||..:|.|::.:|||||  ....|
Human    27 IIGGKEVSPHSRPFMASI-----------QYGGH-----HVCGGVLIDPQWVLTAAHCQYRFTKG 75

  Fly   211 ESPSVALIGGVEL--NSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLAR----RSHMPVACLWN 269
            :||:|.| |...|  |....|.:|||:........::..:||:.:|||..    ..|:.:..:.:
Human    76 QSPTVVL-GAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRS 139

  Fly   270 QESLPE-RPLTALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANG---LGSGQMCA 330
            :.||.. ......|:|.|.......|:.|:    .:......|.|.|.....||   :....:||
Human   140 KTSLRSGTKCKVTGWGATDPDSLRPSDTLR----EVTVTVLSRKLCNSQSYYNGDPFITKDMVCA 200

  Fly   331 GDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGAC-ASGQPGVYVRIA-HYIQWIE 393
            ||..|..|:|:|||||||:. :.:.|         .|.|.|..| .:.:||:|..:. .|..||:
Human   201 GDAKGQKDSCKGDSGGPLIC-KGVFH---------AIVSGGHECGVATKPGIYTLLTKKYQTWIK 255

  Fly   394 QQVWP 398
            ..:.|
Human   256 SNLVP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 69/259 (27%)
Tryp_SPc 149..392 CDD:214473 67/256 (26%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 67/257 (26%)
Tryp_SPc 27..257 CDD:238113 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.