DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and GZMA

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:259 Identity:63/259 - (24%)
Similarity:110/259 - (42%) Gaps:47/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGES 212
            ::||.....:..|||..|....:|                .|..|:||..:.:||||| ::...|
Human    29 IIGGNEVTPHSRPYMVLLSLDRKT----------------ICAGALIAKDWVLTAAHC-NLNKRS 76

  Fly   213 PSVALIGGVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLARRS---------HMPVACLW 268
            ..:.....:.......|::.:|:...:|.:|..|...||.:::|..::         |:|..   
Human    77 QVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKK--- 138

  Fly   269 NQESLPERPLTALGYGQTKFAGPHSSNLLQIMLYHLNFQQC-QRYLHNYDKLANGLGSGQMCAGD 332
            ..:..|.......|:|:|..:...|..|.::.:..::.:.| .|..:|::.:   :|...:|||.
Human   139 GDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPV---IGMNMVCAGS 200

  Fly   333 YSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFG--GACASGQ-PGVYVRIA-HYIQWI 392
            ..|..|:|.||||.|||.....|          |:||||  ..|...: ||||:.:: .::.||
Human   201 LRGGRDSCNGDSGSPLLCEGVFR----------GVTSFGLENKCGDPRGPGVYILLSKKHLNWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 63/258 (24%)
Tryp_SPc 149..392 CDD:214473 61/256 (24%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 61/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.