DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and Gzma

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:261 Identity:67/261 - (25%)
Similarity:112/261 - (42%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGES 212
            ::||.....:..|||..|                |.:....|..|:||..:.:|||||  :.|:.
  Rat    29 IIGGDTVVPHSRPYMVLL----------------KLKPDSICAGALIAKNWVLTAAHC--IPGKK 75

  Fly   213 PSVALIGGVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLARRS---------HMPVACLW 268
            ..|.|...........|::.:|:...:|.||..|...||.:::|.:::         |:|..   
  Rat    76 SEVILGAHSIKKEPEQQILSVKKAYPYPCFDKHTHEGDLQLLRLKKKATLNKNVAILHLPKK--- 137

  Fly   269 NQESLPERPLTALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLH-NYDKLANGLGSGQMCAGD 332
            ..:..|.......|:|:.....|.|..|.::.:..::.:.|....| |::.:   :|...:|||:
  Rat   138 GDDVKPGTRCHVAGWGRFHNKSPPSDTLREVNITVIDRKICNDEKHYNFNPV---IGLNMICAGN 199

  Fly   333 YSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFG--GACASGQ-PGVYVRIA-HYIQWIE 393
            ..|..|:|.||||||||.....|          |||:||  |.|...: ||:|..:: .::.||.
  Rat   200 LRGGKDSCYGDSGGPLLCEGIFR----------GITAFGLEGRCGDPKGPGIYTLLSDKHLDWIR 254

  Fly   394 Q 394
            :
  Rat   255 K 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 67/260 (26%)
Tryp_SPc 149..392 CDD:214473 65/256 (25%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 65/257 (25%)
Tryp_SPc 29..256 CDD:238113 67/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.