DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and CG30375

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:123/265 - (46%) Gaps:48/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 PYMCALGW--PSRTNRWI----HEHGS--SKRRYTFN----CGCAMIAPRFAITAAHC-ASVGGE 211
            |..|..||  |:|....:    ||..|  ..|..:.|    ||.::::.|:.:||||| |.....
  Fly   139 PAPCDCGWSFPNRIANGVEAGKHEFPSMVGLRDLSSNLPIFCGGSIVSERYIMTAAHCTARQPVA 203

  Fly   212 SPSVALIGGVELNSGRGQL----IEIKRISQHPHFDAETLT---NDLAVVKLA-----RRSHMPV 264
            |..:||:|..:|::|...:    ..|:.|..||.: .||.:   ||:|:::.|     .|...|:
  Fly   204 SRLLALVGEHDLSTGAESIYAAQYRIQNIINHPGY-METASGNINDIALLQTATPIEWSRGVAPI 267

  Fly   265 ACL---WNQESLPERPLTALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSG 326
             ||   ..:.|...:.:..:|:|...||...|:.|.:..|..::...|:      .:..:.:...
  Fly   268 -CLPIRQAENSFNYQNVDIMGWGTLGFAASKSNTLQKATLLTMDNAVCR------SRFNSSITPS 325

  Fly   327 QMCAGDYSG-NMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACASGQP---GVYVRIAH 387
            .:|..|..| ..|:||.|||||::|.|..|      .:.:|:.|:|.||  |||   ||..|:..
  Fly   326 HLCTYDAGGRGQDSCQYDSGGPVILRQRER------MFQLGVISYGRAC--GQPFGIGVNTRVTS 382

  Fly   388 YIQWI 392
            ::.|:
  Fly   383 HLNWL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 75/265 (28%)
Tryp_SPc 149..392 CDD:214473 74/263 (28%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 69/250 (28%)
Tryp_SPc 152..387 CDD:238113 68/250 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.