DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and CG30002

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:286 Identity:65/286 - (22%)
Similarity:119/286 - (41%) Gaps:77/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGE 211
            ::.|||.:.....|:|..|            |.:|..... .||.::|:..|.:|||||..:...
  Fly    61 MITGGRKSSLMSQPWMAFL------------HIASDLEMC-RCGGSLISELFVLTAAHCFKMCPR 112

  Fly   212 SPSVAL-IGGVELNSGRG--------------QLIEIKRISQHPHFDAETLTNDLAVVKLAR--- 258
            |..:.: :|.::|:|...              :...|.:...|..|:......|:|::||.:   
  Fly   113 SKEIRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVV 177

  Fly   259 -RSHMPVACLWNQESLPERPLT---------------ALGYGQTKFAGPHSSNLLQIMLYHLNFQ 307
             :.|:...||         |||               |:|:|:|: :..::::.:::.:      
  Fly   178 FKDHIRPICL---------PLTDELLAFTLQLGQRFMAVGWGKTE-SLRYANSTMEVDI------ 226

  Fly   308 QCQRYLHNYDKLANGLGSGQMCA-GDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFG 371
                   ..:|..:|..:..:|| |||   :|||.||||||||....:......:.:  |:.|.|
  Fly   227 -------RTEKCTDGRDTSFLCASGDY---VDTCNGDSGGPLLWKTTLFGKDRAVQF--GVVSTG 279

  Fly   372 GA-CASGQPGVYVRIAHYIQWIEQQV 396
            .. |.:|....|:.:..|:.||.:::
  Fly   280 SQNCGAGHKAYYMDVPTYMPWILEKM 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 65/281 (23%)
Tryp_SPc 149..392 CDD:214473 63/278 (23%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 63/279 (23%)
Tryp_SPc 62..301 CDD:238113 63/279 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.