DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and F10

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:412 Identity:95/412 - (23%)
Similarity:164/412 - (39%) Gaps:123/412 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NCQAHDRPLI----GKCVRYVDCISAMQAVPRVTPLLCPSSWPNQLVCCPHGGYLLPPPSISKSE 103
            ||:...|.|.    |.|.::                 |... .|.:||....||     :::.:.
Human   120 NCELFTRKLCSLDNGDCDQF-----------------CHEE-QNSVVCSCARGY-----TLADNG 161

  Fly   104 QAC--ANAYPRAHHKRRRRRRNT------------------------NPKLDQVELVEPIIQKHN 142
            :||  ...||.......||:|:.                        :|..:..:|::     .|
Human   162 KACIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDPTENPFDLLD-----FN 221

  Fly   143 QSQ------NL--LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFA 199
            |:|      ||  :|||:..::.|.|:...|         |:|....      .||..:::..:.
Human   222 QTQPERGDNNLTRIVGGQECKDGECPWQALL---------INEENEG------FCGGTILSEFYI 271

  Fly   200 ITAAHC--------ASVGGESPSVALIGGVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKL 256
            :|||||        ..||..:        .|...|...:.|::.:.:|..|..||...|:||::|
Human   272 LTAAHCLYQAKRFKVRVGDRN--------TEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRL 328

  Fly   257 AR----RSHMPVACL----WNQESL-PERPLTALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRY 312
            ..    |.::..|||    |.:.:| .::.....|:|:|...|..|:.|..:.:.:::...|   
Human   329 KTPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSC--- 390

  Fly   313 LHNYDKLANG--LGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACA 375
                 ||::.  :.....|||..:...|.||||||||     |:...:.|. :|.||.|:|..||
Human   391 -----KLSSSFIITQNMFCAGYDTKQEDACQGDSGGP-----HVTRFKDTY-FVTGIVSWGEGCA 444

  Fly   376 -SGQPGVYVRIAHYIQWIEQQV 396
             .|:.|:|.::..:::||::.:
Human   445 RKGKYGIYTKVTAFLKWIDRSM 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 69/265 (26%)
Tryp_SPc 149..392 CDD:214473 67/262 (26%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011 1/1 (100%)
FXa_inhibition 129..164 CDD:317114 8/57 (14%)
O-glycosylated at one site 183..203 0/19 (0%)
Tryp_SPc 235..464 CDD:238113 69/265 (26%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.