DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and F7

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_011535776.2 Gene:F7 / 2155 HGNCID:3544 Length:495 Species:Homo sapiens


Alignment Length:390 Identity:101/390 - (25%)
Similarity:168/390 - (43%) Gaps:82/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NCQAHDRPLIGKCV-RYVDCISAMQAVP-RVTPLLCPSSWP---NQLVCCPHGGYLLPPPSISKS 102
            ||:..:.|...:.: |...|.|:...:| .:...|.||| |   :||:|....|         ..
Human   133 NCETQESPASWRRLKREASCWSSGSRMPGDLCSALVPSS-PDKDDQLICVNENG---------GC 187

  Fly   103 EQACANAYPRAHHKRRRRRR------------NTNPKLDQVELVEPIIQKHNQS--QNLLVGGRL 153
            ||.|::     |...:|..|            :..|.::......||::|.|.|  |..:|||::
Human   188 EQYCSD-----HTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKV 247

  Fly   154 TQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHC-ASVGGESPSVAL 217
            ..:.|.|:...|          ..:|:..      ||..:|...:.::|||| ..:......:|:
Human   248 CPKGECPWQVLL----------LVNGAQL------CGGTLINTIWVVSAAHCFDKIKNWRNLIAV 296

  Fly   218 IGGVELNSGRGQLIEIKRISQ---HPHFDAETLTNDLAVVKLARRSHMPVA--------CLWNQE 271
            :|..:|:...|. .:.:|::|   ...:...|..:|:|:::|    |.||.        || .:.
Human   297 LGEHDLSEHDGD-EQSRRVAQVIIPSTYVPGTTNHDIALLRL----HQPVVLTDHVVPLCL-PER 355

  Fly   272 SLPERPLTAL------GYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCA 330
            :..||.|..:      |:||....|..:..|:.:.:..|..|.|.:.........| :.....||
Human   356 TFSERTLAFVRFSLVSGWGQLLDRGATALELMVLNVPRLMTQDCLQQSRKVGDSPN-ITEYMFCA 419

  Fly   331 GDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACAS-GQPGVYVRIAHYIQWIEQ 394
            |...|:.|:|:||||||     |..|:|.|. |:.||.|:|..||: |..|||.|::.||:|:::
Human   420 GYSDGSKDSCKGDSGGP-----HATHYRGTW-YLTGIVSWGQGCATVGHFGVYTRVSQYIEWLQK 478

  Fly   395  394
            Human   479  478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 72/265 (27%)
Tryp_SPc 149..392 CDD:214473 71/261 (27%)
F7XP_011535776.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.