DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and try-1

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:299 Identity:80/299 - (26%)
Similarity:126/299 - (42%) Gaps:69/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 NTNPKLDQV----ELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKR 183
            :||.:|.|.    |..:.:...|.     |:||  ::.:.|      .||     |..:..|  |
 Worm    34 STNVELAQTRSAQEPADYVTLDHR-----LIGG--SESSPH------SWP-----WTVQLLS--R 78

  Fly   184 RYTFNCGCAMIAPRFAITAAHCASVGGESPSVAL-IGGVELNSGRGQLIEIKRISQHPHFDAETL 247
            .....||.::|.|.|.:|||||.:......|.:: :||  ..||.|....:..:|.||.::....
 Worm    79 LGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGG--HRSGSGSPHRVTAVSIHPWYNIGFP 141

  Fly   248 TN-DLAVVKLARRSHMPV--------ACLWNQESLPERPLTALGYGQT----KFAGPHSSNLLQI 299
            :: |.|::::    |.||        .||.:..::..|.....|:|.|    ..:.|   .|.:|
 Worm   142 SSYDFAIMRI----HPPVNTSTTARPICLPSLPAVENRLCVVTGWGSTIEGSSLSAP---TLREI 199

  Fly   300 MLYHLNFQQCQRYLHNYDKLANGLG----SGQMCAGDYSGNMDTCQGDSGGPLLLHQ--HMRHHR 358
            .:..|:...|       ..|.|.:|    ...:|||...|.:|:|||||||||:..:  |..   
 Worm   200 HVPLLSTLFC-------SSLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMCARDGHWE--- 254

  Fly   359 HTIPYVVGITSFGGACA-SGQPGVYVRIAHYIQWIEQQV 396
                 :.|:.|:|..|| .|.||||..:.....||..::
 Worm   255 -----LTGVVSWGIGCARPGMPGVYGNVHSASTWINLEM 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 73/266 (27%)
Tryp_SPc 149..392 CDD:214473 71/263 (27%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 72/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.