DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and Gzmk

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:284 Identity:72/284 - (25%)
Similarity:125/284 - (44%) Gaps:49/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 VELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIA 195
            |.||..:..........::|||..|.:..|:|.::.:.|:                ..||..:|.
Mouse     9 VSLVAGVYMSSECFHTEIIGGREVQPHSRPFMASIQYRSK----------------HICGGVLIH 57

  Fly   196 PRFAITAAHCAS--VGGESPSVALIGGVEL--NSGRGQLIEIKRISQHPHFDAETLTNDLAVVKL 256
            |::.:|||||.|  ..|.||:|.| |...|  |....|..|||:........:.:.::|:.::||
Mouse    58 PQWVLTAAHCYSWFPRGHSPTVVL-GAHSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKL 121

  Fly   257 AR----RSHMPVACLWNQESLPE-RPLTALGYGQTKFAGPH----SSNLLQIMLYHLNFQQC--Q 310
            ..    ..::.:..|.::..|.: ......|:|.||   |.    |..|.::.:..::.::|  |
Mouse   122 RTAAELNKNVQLLHLGSKNYLRDGTKCQVTGWGTTK---PDLLTASDTLREVTVTIISRKRCNSQ 183

  Fly   311 RYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACA 375
            .|.::...:...:    :||||..|..|:|:|||||||:. :.:.|...:..|..||..      
Mouse   184 SYYNHKPVITKDM----ICAGDARGQKDSCKGDSGGPLIC-KGIFHALVSQGYKCGIAK------ 237

  Fly   376 SGQPGVYVRIA-HYIQWIEQQVWP 398
              :||:|..:. .|..||:.::.|
Mouse   238 --KPGIYTLLTKKYQTWIKSKLAP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 68/261 (26%)
Tryp_SPc 149..392 CDD:214473 66/258 (26%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 66/260 (25%)
Tryp_SPc 26..256 CDD:238113 68/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.