DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and F9

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:393 Identity:88/393 - (22%)
Similarity:155/393 - (39%) Gaps:114/393 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GKCVRYVDCISAMQAVPRVTPLLCPSSWPNQLVCCPHGGYLLPPPSISKSEQACANAYP----RA 113
            |:|.::                 |.:|..|:::|....||     .:::.:::|....|    ||
Mouse   139 GRCKQF-----------------CKNSPDNKVICSCTEGY-----QLAEDQKSCEPTVPFPCGRA 181

  Fly   114 ----HHKRRRRRRNTNPKLDQVELVEPI--------------IQKHNQSQN---LLVGGRLTQEN 157
                ..|:..|.......:|.....|.:              :.:.::|.|   .:|||    ||
Mouse   182 SISYSSKKITRAETVFSNMDYENSTEAVFIQDDITDGAILNNVTESSESLNDFTRVVGG----EN 242

  Fly   158 EHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGGVE 222
            ..|..  :.|....|..|...          ||.|:|..::.:|||||...|.:   :.::.| |
Mouse   243 AKPGQ--IPWQVILNGEIEAF----------CGGAIINEKWIVTAAHCLKPGDK---IEVVAG-E 291

  Fly   223 LNSGRGQLIEIKR--ISQHPHFDAETLTN----DLAVVKLAR----RSHMPVACLWNQESLPERP 277
            .|..:.:..|.:|  |...||.......|    |:|:::|.:    .|::...|:.|:|      
Mouse   292 YNIDKKEDTEQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPICVANRE------ 350

  Fly   278 LTAL----------GYGQTKFAGPHSSNLLQIMLYHLNFQQCQR----YLHNYDKLANGLGSGQM 328
            .|.:          |:|:....|..:|.|..:.:..::...|.|    .::|          ...
Mouse   351 YTNIFLKFGSGYVSGWGKVFNKGRQASILQYLRVPLVDRATCLRSTTFTIYN----------NMF 405

  Fly   329 CAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACA-SGQPGVYVRIAHYIQWI 392
            |||...|..|:|:||||||     |:.....| .::.||.|:|..|| .|:.|:|.:::.|:.||
Mouse   406 CAGYREGGKDSCEGDSGGP-----HVTEVEGT-SFLTGIISWGEECAMKGKYGIYTKVSRYVNWI 464

  Fly   393 EQQ 395
            :::
Mouse   465 KEK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 70/270 (26%)
Tryp_SPc 149..392 CDD:214473 68/267 (25%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:291342 8/52 (15%)
Tryp_SPc 236..464 CDD:214473 68/269 (25%)
Tryp_SPc 237..467 CDD:238113 70/271 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.