DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and LOC101886682

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_005170582.2 Gene:LOC101886682 / 101886682 -ID:- Length:252 Species:Danio rerio


Alignment Length:257 Identity:67/257 - (26%)
Similarity:112/257 - (43%) Gaps:54/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 GRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSV 215
            |...:.:..|||.:|...|       :|         .||.::|:..|.:|||||..  .:....
Zfish    30 GTEAKPHSRPYMVSLQINS-------QH---------ICGGSLISKEFVLTAAHCWD--KDDVLT 76

  Fly   216 ALIGGVELNSGRGQLI----EIKRISQHPHFDAETLTNDLAVVKLARRSHMP-----VACLWNQE 271
            .:.|..:|   |.:.|    ::.....||.:::.||.||:.::||..:..:.     ::...|.|
Zfish    77 VVTGAHDL---RKKAIYNTFKVTSYIPHPDYNSYTLENDIMLLKLKTKVRLSNSVGLISLPRNGE 138

  Fly   272 SLPERPLTAL-GYGQTKFAGPHSSNLLQIMLYHLNFQQCQ-RYLHNYDKLANGLGSGQMCAGDYS 334
            .|....|.:: |:|:....|..:..|.:.....:|..:|: |:..:|      :.|..:||..:.
Zfish   139 DLKADTLCSIAGWGRLWRKGAKTDRLREAETVIVNDAECERRWESDY------VASKMICAYGHG 197

  Fly   335 GNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGG--ACASGQ-PGVYVRIAHYIQWIE 393
            |   ||.|||||||:.:.          ..||||:|..  .|.|.. |.|:.||:.|:.||:
Zfish   198 G---TCSGDSGGPLVCNN----------TAVGITAFSDRYLCKSRLFPDVFARISAYLPWIQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 67/257 (26%)
Tryp_SPc 149..392 CDD:214473 65/254 (26%)
LOC101886682XP_005170582.2 Tryp_SPc 27..248 CDD:238113 67/257 (26%)
Tryp_SPc 27..245 CDD:214473 65/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.