DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and LOC101733035

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_031749230.1 Gene:LOC101733035 / 101733035 -ID:- Length:216 Species:Xenopus tropicalis


Alignment Length:184 Identity:37/184 - (20%)
Similarity:67/184 - (36%) Gaps:38/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 ALIGGVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLARRSHMPVACLWNQESLPERPLTA 280
            |.:|...|...:...|.:.|...|..:.......::|:::|:..|:.....|  |||        
 Frog    17 AALGAYNLTERKQFYIPVSRTIIHDRYIYPVYYYNIALLELSTDSNQLPFIL--QES-------- 71

  Fly   281 LGYGQTKFAGPHSSNLLQIMLYHLNFQQCQ-RYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDS 344
                             ::.|  ::.::|: .|...|..:.  :.....||.|...|.....||.
 Frog    72 -----------------EVQL--ISLERCRDLYREAYTNIL--IADTMTCAMDIHENTGISTGDL 115

  Fly   345 GGPLLLHQHMRHHRHTIPYVVGITSFGGACASGQPGVYVRIAHYIQWIEQQVWP 398
            ||||:..:..:.      ::||:.|.........|..|..:..|:.||.:.|:|
 Frog   116 GGPLVCQKGGQW------FLVGVVSLEVILELTLPVSYTSVPAYMDWINKHVFP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 35/179 (20%)
Tryp_SPc 149..392 CDD:214473 33/176 (19%)
LOC101733035XP_031749230.1 Tryp_SPc <19..160 CDD:419748 34/177 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.