DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and XB5962685

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_002941155.3 Gene:XB5962685 / 100496550 XenbaseID:XB-GENE-5962686 Length:251 Species:Xenopus tropicalis


Alignment Length:261 Identity:65/261 - (24%)
Similarity:114/261 - (43%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGES 212
            :.||:....:...||..:    ||       ||:.      ||..:|...:.:|||.|..  ..:
 Frog    23 ITGGKEAIPHARRYMALV----RT-------GSNL------CGGTLIKDNWVLTAATCKV--DRT 68

  Fly   213 PSVAL-IGGVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLARRSHMPVACLWNQESLPE- 275
            .:|.| :..::..:...|..::.|...|..||..:..|:|.:::|:.:::...|.  |...||. 
 Frog    69 TTVDLGVHSIKTMNKLRQQFKVARWVPHQKFDRRSYVNNLQLLQLSSKANFSYAV--NILLLPTK 131

  Fly   276 ----RPLT---ALGYGQTKFAGPHSSN-LLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGD 332
                :|.|   ..|:|.|.:.|...|: |:::.|..|:..||.....:..|:...:    ||..|
 Frog   132 YKDIKPGTVCETAGWGITAYNGKQQSDKLMEVSLTVLDRMQCNNQWKSKIKITKDM----MCTRD 192

  Fly   333 YSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACASGQPG--VYVRI-AHYIQWIEQ 394
             .|....|.||.||||:.::          .:.|:.|||......:.|  ||.|: ::||:||::
 Frog   193 -KGKRGFCNGDGGGPLICNR----------ILTGVISFGPLICGMENGANVYTRLTSNYIKWIKK 246

  Fly   395 Q 395
            :
 Frog   247 E 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 65/258 (25%)
Tryp_SPc 149..392 CDD:214473 63/255 (25%)
XB5962685XP_002941155.3 Tryp_SPc 23..246 CDD:238113 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.