DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and gzma

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:292 Identity:76/292 - (26%)
Similarity:122/292 - (41%) Gaps:55/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 RRNTNPKLDQVE--LVEPIIQKHNQSQNL---LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGS 180
            |..|:|::....  |:..|:...:.:.|:   ::.||....:..|||..:  .|||.        
 Frog     3 RSQTSPRMRLFSFCLLSSILLLIHINGNICMDIIDGREAASHSRPYMAYI--YSRTG-------- 57

  Fly   181 SKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGG--VELNSGRGQLIEIKRISQHPHFD 243
                   :||..:|...:.:|||||.....|    .::|.  |:......|...:.|...||.|:
 Frog    58 -------SCGGTLIKQNWVLTAAHCVVNNSE----VILGAHKVKSRENEQQRFSVARAIPHPCFE 111

  Fly   244 AETLTNDLAV--VKLARRSHMPVACL----WNQESLPERPLTALGYGQTKFAGPHSSNLLQIMLY 302
            .:...:|:.:  :|.|.:.:..|:.|    .:.:..|....:..|:|.||..|...|::|:    
 Frog   112 WKKKIHDIQLLQIKGAAKLNKFVSVLKLPTTDMDVKPGSSCSTAGWGVTKPNGKTPSDVLR---- 172

  Fly   303 HLNFQQCQRYLHN--YDKLANGLGSGQMCAG---DYSGNMDTCQGDSGGPLLLHQHMRHHRHTIP 362
            .:|.....|...|  |.|....:.:..:|||   ......|.|||||||||:..:...       
 Frog   173 EVNVTVVDRGTCNKIYKKFKTEISTNMLCAGAPKKSDKKYDACQGDSGGPLICGKEFS------- 230

  Fly   363 YVVGITSFGGACASGQ-PGVYVRI-AHYIQWI 392
               ||.|||..|...: ||:|.|: |.|:|||
 Frog   231 ---GIVSFGKKCGDPKYPGIYTRLTARYLQWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 70/259 (27%)
Tryp_SPc 149..392 CDD:214473 68/257 (26%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 70/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.