DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ry and AT4G37500

DIOPT Version :9

Sequence 1:NP_524337.1 Gene:ry / 41605 FlyBaseID:FBgn0003308 Length:1335 Species:Drosophila melanogaster
Sequence 2:NP_195466.1 Gene:AT4G37500 / 829905 AraportID:AT4G37500 Length:124 Species:Arabidopsis thaliana


Alignment Length:91 Identity:44/91 - (48%)
Similarity:62/91 - (68%) Gaps:7/91 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1019 LNQAGSLINIYGDGSVLLSHGGVEIGQGLNTKMIQCAARALGIPSELIHISETATDKVPNTSPTA 1083
            |.|||:|:::..:|:||::|||||:|||.       |.:...||...:.:|||:|.||||.||||
plant    31 LLQAGALVHVCTNGTVLVTHGGVEMGQGF-------AYKGCVIPLSSVFVSETSTYKVPNASPTA 88

  Fly  1084 ASVGSDLNGMAVLDACEKLNKRLAPI 1109
            ||..||:.|.|||||.|::..:|.|:
plant    89 ASASSDMYGAAVLDAVEQIIAKLEPV 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ryNP_524337.1 Fer2 8..78 CDD:278537
PLN02906 25..1317 CDD:215491 44/91 (48%)
Fer2_2 87..158 CDD:280048
FAD_binding_5 231..411 CDD:279309
CO_deh_flav_C 422..525 CDD:281449
Ald_Xan_dh_C 589..696 CDD:279635
Ald_Xan_dh_C2 716..1242 CDD:280834 44/91 (48%)
AT4G37500NP_195466.1 PLN02906 <33..122 CDD:215491 43/89 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.