DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ry and AT3G04390

DIOPT Version :10

Sequence 1:NP_524337.1 Gene:ry / 41605 FlyBaseID:FBgn0003308 Length:1335 Species:Drosophila melanogaster
Sequence 2:NP_187089.1 Gene:AT3G04390 / 819594 AraportID:AT3G04390 Length:79 Species:Arabidopsis thaliana


Alignment Length:63 Identity:30/63 - (47%)
Similarity:41/63 - (65%) Gaps:3/63 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1047 LNTKMIQCAARALGIPSELIHISETATDKVPNTSPTAASVGSDLNGMAVLDACEKLNKRLAPI 1109
            ::||:   ||.|..||...:.:|||:|.||||.||||||..||:.|.||||..:.:..:|.|:
plant    10 MHTKV---AAAAFNIPLSSVFVSETSTYKVPNASPTAASASSDMYGPAVLDDVKHIIAKLEPV 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ryNP_524337.1 PLN02906 25..1317 CDD:215491 30/63 (48%)
AT3G04390NP_187089.1 PLN02906 <10..77 CDD:215491 30/63 (48%)

Return to query results.
Submit another query.