DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtBP and CG9331

DIOPT Version :9

Sequence 1:NP_001262522.1 Gene:CtBP / 41602 FlyBaseID:FBgn0020496 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001188859.1 Gene:CG9331 / 35347 FlyBaseID:FBgn0032889 Length:364 Species:Drosophila melanogaster


Alignment Length:291 Identity:81/291 - (27%)
Similarity:127/291 - (43%) Gaps:25/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SEIHEKVLNEAVGALMW--HTIILTKEDLEKF-KALRIIVRIGSGTDNIDVKAAGELGIAVCNVP 121
            :|:.||:  ..|..::|  |. .|..|.|:.. ..|:.|..:.:|.|.:||.......|.:.:.|
  Fly    79 AELLEKI--RGVDGVLWGGHE-PLNAEALDAAGPQLKSISTMSAGIDYVDVPEVKRRKIPLGHTP 140

  Fly   122 GYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAH-----GCARIRGDTLGLVG 181
            ......|||..:.|::...||.:       ||:| |......|..|     | ..||..|:|..|
  Fly   141 TVLNTAVADLAVGLLIAASRRFH-------EGRK-TIDNDKWENYHLNWLLG-QDIRDSTVGFYG 196

  Fly   182 LGRIGSAVALRAKAFGFNVIFYDP--YLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNH 244
            .|.||.|:|.|...|..:.:.|..  .:...|::.....:| ....||.:||.|.:...|.:...
  Fly   197 FGGIGQAIAKRLSGFDIDKVLYTTRRRVHKEIEEEFNAKKV-DFDTLLAESDFVVIASPLTKDTQ 260

  Fly   245 HLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYN--GALKDAPNL 307
            .:.|.....:|:..|.|||.|||.:|:.:.|..|||..||.:|.|||.:.||.:  ..|....|:
  Fly   261 GVFNATAFNKMKQTAVLVNIARGKIVNQDDLYEALKANRIFSAGLDVTDPEPLSPKDKLLTLDNV 325

  Fly   308 ICTPHAAFFSDASATELREMAATEIRRAIVG 338
            :..||....:..:..::..:||..:.|.:.|
  Fly   326 VVLPHIGSATKRTRADMSTIAAHNVLRGLAG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtBPNP_001262522.1 CtBP_dh 28..342 CDD:240624 81/291 (28%)
LdhA 45..351 CDD:223980 81/291 (28%)
CG9331NP_001188859.1 LdhA 46..358 CDD:223980 81/291 (28%)
GDH 46..356 CDD:240626 80/289 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.