DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtBP and CG6287

DIOPT Version :9

Sequence 1:NP_001262522.1 Gene:CtBP / 41602 FlyBaseID:FBgn0020496 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_609496.1 Gene:CG6287 / 34554 FlyBaseID:FBgn0032350 Length:332 Species:Drosophila melanogaster


Alignment Length:347 Identity:101/347 - (29%)
Similarity:161/347 - (46%) Gaps:58/347 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDL----EKFKA----------- 91
            ||:  ::..|..|||...|.:.   |.|..|..:.:.:.|..|:|    :.|.|           
  Fly     1 MPL--NIRKVLVCDAVDKSCVE---LLEQHGIKVTYKLKLPVEELCQEVKNFDAAIVRSDTKITA 60

  Fly    92 ---------LRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLA 147
                     |:::.|.|:|.|||||.||....:.|.|.||.......:.|..||.:|.|......
  Fly    61 EVLAAGSGSLKVVGRAGAGVDNIDVPAATAQNVVVLNTPGGNSISACELTCILIGSLARPVVPAG 125

  Fly   148 NMVREG----KKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLP 208
            ..::||    |.:.|.|           :.|.||.::||||||..||:|.|.:|..:|.|||...
  Fly   126 QSMKEGRWDRKLYAGTE-----------LYGKTLAVLGLGRIGREVAIRMKTWGMRIIGYDPITT 179

  Fly   209 DGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDE 273
            :...|:.|:.:: ||:::...:|.:::|..|.....:||:..|:.:.:.|..:||.||||::|::
  Fly   180 EAEAKAAGIEKM-TLEEIWPLADYITVHTPLIPATRNLISAETLAKCKQGVKVVNVARGGIIDEQ 243

  Fly   274 TLALALKQGRIRAAALDVHENEPYNGALKDA----PNLICTPHAAFFSDASATELREMAATEIRR 334
            .:...|:.|::..||.||:..||...|:..|    |.::.|||..    ||.:|.:...|.|:..
  Fly   244 AVLDGLESGKVAGAAFDVYPEEPPKSAVTKALISHPKVVATPHLG----ASTSEAQVRVAVEVAE 304

  Fly   335 ---AIVGNIPDV--LRNCVNKE 351
               |:.|..|..  ....:|||
  Fly   305 QFIALNGTSPKYTSYAGVINKE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtBPNP_001262522.1 CtBP_dh 28..342 CDD:240624 97/334 (29%)
LdhA 45..351 CDD:223980 97/342 (28%)
CG6287NP_609496.1 SerA 5..315 CDD:223189 95/328 (29%)
PGDH_4 7..311 CDD:240650 94/322 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438671
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0111
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D305212at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3406
SonicParanoid 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.