DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtBP and CG31674

DIOPT Version :9

Sequence 1:NP_001262522.1 Gene:CtBP / 41602 FlyBaseID:FBgn0020496 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001286111.1 Gene:CG31674 / 318878 FlyBaseID:FBgn0051674 Length:327 Species:Drosophila melanogaster


Alignment Length:336 Identity:89/336 - (26%)
Similarity:143/336 - (42%) Gaps:45/336 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RPLVALLDGRDCSIE-MPILK---DVATVAFCDAQSTSEIHEKVLNEAVGALMW-HTIILTKEDL 86
            :|...|:...|...| :.|||   ::..|.....::..||.||:  ....|::| ...||..|.|
  Fly     5 KPFKVLIAHTDVPPEGIEILKEQCEILQVINEPPKNRPEILEKI--RGAHAVIWGGRDILNAEIL 67

  Fly    87 EKF-KALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMV 150
            :.. ..|:.:..:.||.:|:||....:.||.:.:.|......|||.|:.|::...||       .
  Fly    68 DAAGPQLKAVSTMSSGINNVDVPELKKRGIPLGSTPAMLTVAVADLTVGLLIAAARR-------F 125

  Fly   151 REGKK--------------FTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVI 201
            :||::              ..|.:           ||..|:|..|.|.||.|||.|...|....:
  Fly   126 QEGRRKIDSDKWDKDHLNWMLGQD-----------IRDSTVGFYGFGGIGQAVAKRLMGFDIKRM 179

  Fly   202 FYDP--YLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNT 264
            .|..  .:...|::.....:| ..:.||.:||.:.:...|.:....|.|.....:|:..|.|||.
  Fly   180 LYTTRNRVSQDIEERFNAKKV-DFETLLAESDFLIIASPLTKETLGLFNATVFNKMKETAVLVNV 243

  Fly   265 ARGGLVDDETLALALKQGRIRAAALDVHENEPY--NGALKDAPNLICTPHAAFFSDASATELREM 327
            .||.:|:.:.|..|||..||.||.|||.:.||.  |..|....|::.|||..:.:..:..:...:
  Fly   244 GRGKIVNQDDLYEALKSNRIFAAGLDVMDPEPLPSNDKLLTLDNVVVTPHVGYATRRTRVDAANL 308

  Fly   328 AATEIRRAIVG 338
            |:..:.:.:.|
  Fly   309 ASRNVLKGLAG 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtBPNP_001262522.1 CtBP_dh 28..342 CDD:240624 89/335 (27%)
LdhA 45..351 CDD:223980 84/317 (26%)
CG31674NP_001286111.1 GDH 8..319 CDD:240626 87/331 (26%)
LdhA 9..321 CDD:223980 88/332 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.