DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8031 and Memo1

DIOPT Version :9

Sequence 1:NP_650252.1 Gene:CG8031 / 41601 FlyBaseID:FBgn0038110 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_598532.1 Gene:Memo1 / 76890 MGIID:1924140 Length:297 Species:Mus musculus


Alignment Length:288 Identity:188/288 - (65%)
Similarity:225/288 - (78%) Gaps:1/288 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRATHAGSWYTDSGAELSRQLDRWLGAADLSHGPARAIIAPHAGYTYCGACAAFAYRQVSPVVVK 68
            |.|:|||||||.||.:|:.||:.||.....:..||||||||||||||||:|||.||:||.|.|.:
Mouse     8 REASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSVTR 72

  Fly    69 RIFILGPSHHVRLRGCALSVAKKYRTPLYDLKIDAQINSELEKTGKFSWMDMKTDEDEHSIEMHL 133
            |||||||||||.|..||||....||||||||:||.:|..||.|||.|..|.::||||||||||||
Mouse    73 RIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHL 137

  Fly   134 PYIAKVMEDYKDQFTIVPILVGSLNPEQEAQYGSLLSSYLMDPTNLFVISSDFCHWGHRFSYTYY 198
            ||.||.||.:||:|||:|:|||:|:..:|.::|.|.|.||.||:||||:||||||||.||.|:||
Mouse   138 PYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYY 202

  Fly   199 DSSCGAIHKSIEKLDKQGMDIIESLNPHSFTEYLRKYNNTICGRHPIGVMLGAVKALQDQGYDKM 263
            |.|.|.|::|||.|||.||.|||.|:|.||:.||:||:|||||||||||:|.|:..||..|.: |
Mouse   203 DESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMN-M 266

  Fly   264 SFKFLKYAQSSQCQDIEDSSVSYASGSL 291
            ||.||.|||||||:..:|||||||:|:|
Mouse   267 SFSFLNYAQSSQCRSWQDSSVSYAAGAL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8031NP_650252.1 MEMO_like 5..289 CDD:153373 185/283 (65%)
Memo1NP_598532.1 MEMO_like 9..294 CDD:153373 186/285 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833274
Domainoid 1 1.000 389 1.000 Domainoid score I783
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6272
Inparanoid 1 1.050 394 1.000 Inparanoid score I1961
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60655
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004912
OrthoInspector 1 1.000 - - oto95310
orthoMCL 1 0.900 - - OOG6_101032
Panther 1 1.100 - - LDO PTHR11060
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1709
SonicParanoid 1 1.000 - - X3464
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.