DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MC4R and Dop1R1

DIOPT Version :9

Sequence 1:NP_005903.2 Gene:MC4R / 4160 HGNCID:6932 Length:332 Species:Homo sapiens
Sequence 2:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster


Alignment Length:393 Identity:105/393 - (26%)
Similarity:168/393 - (42%) Gaps:118/393 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    11 TSLHLWNRSSYRLHSNASES---LGKGYSDGGCYEQLFVSPE-----VFVTLGV-------ISLL 60
            |....:|.||:   :||||.   :|:             .||     ..|.:|:       :|:.
  Fly    96 TLTSFYNESSW---TNASEMDTIVGE-------------EPEPLSLVSIVVVGIFLSVLIFLSVA 144

Human    61 ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDT------DAQSFTV 119
            .||||.:||...::|......|:.|||:||:.|:      ::|:|.....|.      .||.   
  Fly   145 GNILVCLAIYTERSLRRIGNLFLASLAIADLFVA------SLVMTFAGVNDLLGYWIFGAQF--- 200

Human   120 NIDN-VIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGII-ISCIW-AACTVSG 181
             .|. |...|:||:  |||.:|.:|::|||..|...|:|...:| :||.:| |:.|| .|..||.
  Fly   201 -CDTWVAFDVMCST--ASILNLCAISMDRYIHIKDPLRYGRWVT-RRVAVITIAAIWLLAAFVSF 261

Human   182 ILF----------IIYSDSS--------------AVIICLITMFFTMLALMASLYVHMFLMARLH 222
            :..          :|:.|:.              ||:...|:.:|..: :|..:|..::..|:.|
  Fly   262 VPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVSSCISFYFPCV-VMIGIYCRLYCYAQKH 325

Human   223 IKRIAVL--PGTGA-------IRQGANM---------------------KGAITLTILIGVFVVC 257
            :|.|..:  ||..|       ||:..|.                     |.|:|:.:::|||::|
  Fly   326 VKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMGVFLIC 390

Human   258 WAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPLIYALRSQELRKTFKEII----- 317
            |.|||...|....|..   |:...: |.:...|...||..:|:||::.::|.|..||.|:     
  Fly   391 WVPFFCVNITAAFCKT---CIGGQT-FKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRILTMRNP 451

Human   318 -CC 319
             ||
  Fly   452 WCC 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MC4RNP_005903.2 7tmA_MC4R 45..313 CDD:320475 91/342 (27%)
TM helix 1 46..72 CDD:320475 11/37 (30%)
TM helix 2 79..105 CDD:320475 8/25 (32%)
TM helix 3 122..152 CDD:320475 13/30 (43%)
TM helix 4 164..184 CDD:320475 9/21 (43%)
TM helix 5 189..218 CDD:320475 7/42 (17%)
TM helix 6 238..268 CDD:320475 13/50 (26%)
TM helix 7 281..306 CDD:320475 7/24 (29%)
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 46/144 (32%)
7tm_1 145..431 CDD:278431 82/303 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.