DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17327 and si:dkey-19e4.5

DIOPT Version :10

Sequence 1:NP_731760.1 Gene:CG17327 / 41598 FlyBaseID:FBgn0038107 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001313497.1 Gene:si:dkey-19e4.5 / 570260 ZFINID:ZDB-GENE-030131-1852 Length:189 Species:Danio rerio


Alignment Length:117 Identity:44/117 - (37%)
Similarity:61/117 - (52%) Gaps:2/117 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLALVVRTDLKMSKGKTAAQCAHAAVMCYQSSVQGTKLQNAILQRWCRLGQPKIVLRVDNFEQLN 87
            |:..||..:|.|..||.|||..||||..|| ::|.......:..:|...|..||||:..|...|.
Zfish    75 KMVFVVNMELSMGVGKVAAQVGHAAVGLYQ-ALQEKNSWREMAWKWDHAGAKKIVLQGTNMAHLL 138

  Fly    88 SLERQAQESNVVAALVRDAGRTQLESGTATVLGLGPAPAEDLDKLVAHLKLL 139
            .|:..|...::...||:|||.||:|.|:.|||.: ....|.::.:...||||
Zfish   139 ELQALAMSLSLPTKLVQDAGLTQVEPGSCTVLAI-IGEEEMVNNVTGSLKLL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17327NP_731760.1 PTH2 23..139 CDD:239108 42/115 (37%)
si:dkey-19e4.5NP_001313497.1 UBA_like_SF 25..59 CDD:473871
PTH2 74..189 CDD:239108 42/115 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.