DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f2 and yellow-e3

DIOPT Version :9

Sequence 1:NP_650247.1 Gene:yellow-f2 / 41596 FlyBaseID:FBgn0038105 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_650288.1 Gene:yellow-e3 / 41651 FlyBaseID:FBgn0038150 Length:409 Species:Drosophila melanogaster


Alignment Length:343 Identity:87/343 - (25%)
Similarity:154/343 - (44%) Gaps:31/343 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RGRLFVTMPRRRVGIPSTLNYIDLAEDGSNRSPKLRAYPNFALNQFNASAENLVSVYRTSVDACQ 174
            |.|.|:|:||..:..|.||..:....:....:|:|..|||...:....:...:.|..||.:|.|.
  Fly    57 RHRTFLTIPRLGMATPFTLATVIAEHNELVENPRLEPYPNEEWHVPPNNCSGITSAIRTYIDECW 121

  Fly   175 RLWFIDTGMLEYPNNRQQIRRPSIWVVDLATDQVLKRFDV-PESIAETGRGLASITVDV----KA 234
            |||.:|:|.:    |..|:..|.|...||..|::::|..: |:|...:.....::.||:    ..
  Fly   122 RLWVVDSGQV----NSLQLCPPQILTFDLVKDELVQRHALPPDSYIPSVSIFTALVVDLAERGTP 182

  Fly   235 GQCGDAYAYIPDLVYRRLYVYHLRNDRIWSFEHNYFNFDPLSGDLSIGGQTFRWDDGIFSITLGA 299
            .:|....|||.|.....|.|:.....|.|..||......||   |.: |::.....|||:::|..
  Fly   183 NRCVGGRAYIADAWGYGLIVFDSLTGRSWRIEHESMKPSPL---LRL-GRSSNSQAGIFTVSLSP 243

  Fly   300 QKLDGSRDAYFHPMASTNEF-----VVSNRVLQQESNAARSDHGNDFRVLGSRGPSTQSTMHAYD 359
            .::: .|..|||.:.|.||.     :::|....:.:||:|    :.|..||:||...:|.:.   
  Fly   244 SEVE-DRFLYFHTLNSFNEMRVPLSLINNETFWKSANASR----DSFHSLGTRGIQCESEVM--- 300

  Fly   360 PGTGVIFFDEIQRNGVGCWKTS-KPISAENYGSVDSNAEDMIYPSDLSIDEDG----TIWVMSNS 419
            ..:|.::...|....:..|:.| ...:|::...|..|...:.:.:.|.|:.:.    .:|.:|:.
  Fly   301 DQSGNLYCSLISLGALVKWEESVSNYTADDLRVVAYNPHKIKFVTGLKINRNSKGEEELWALSSQ 365

  Fly   420 MPIFIYSTLDTSIYNFRI 437
            ..:|:...|..:...|:|
  Fly   366 PKLFVGGDLPANEVKFQI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-f2NP_650247.1 MRJP 163..451 CDD:281074 73/290 (25%)
yellow-e3NP_650288.1 MRJP 110..397 CDD:281074 73/290 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449233
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.