DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f2 and yellow-d2

DIOPT Version :9

Sequence 1:NP_650247.1 Gene:yellow-f2 / 41596 FlyBaseID:FBgn0038105 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster


Alignment Length:338 Identity:91/338 - (26%)
Similarity:164/338 - (48%) Gaps:22/338 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LFVTMPRRRVGIPSTLNYI--DLAEDGSNRSPKLRAYPNFALNQ-FNASAENLVSVYRTSVDACQ 174
            :|||:||...|:|.:|.|:  ::..:|:    .|:|||::..:: ..|....|.|||||.:|.|.
  Fly    73 IFVTIPRFAKGVPYSLAYVTNEMRPNGT----LLQAYPSYEWHKSHGADCNGLTSVYRTQIDECG 133

  Fly   175 RLWFIDTGMLEYPNNRQQIRRPSIWVVDLATDQVLKRFDVPESIAETG-RGLASITVDVKAGQCG 238
            |:|.:|:|.:::    .|...|.::.:||.:.:|..::.:|:.:.:.| ....:.||::....|.
  Fly   134 RMWILDSGEIDF----IQHCPPQLYAIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVELDPHNCD 194

  Fly   239 DAYAYIPDLVYRRLYVYHLRNDRIWSFEHNYFNFDPLSGDLSIGGQTFRWDDGIFSITLGAQKLD 303
            ..:.|:.|.:...:.||.:...:.|..|:.:....|..|..:|.|::|:..||..|.||....|.
  Fly   195 VGFVYMADSIGDGIVVYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLG 259

  Fly   304 GSRDAYFHPMASTNEFVVSNRVLQQESNAARSDHG---NDFRVLGSRGPSTQSTMHAYDPGTGVI 365
            |.|..|||.::|..:..:...|:...||...:|..   :.|::||.||  :|....|... :|.:
  Fly   260 GRRMMYFHSLSSEWQMAIPLDVVNNGSNWRLNDVSAALDQFQLLGKRG--SQCVAAAMSE-SGFL 321

  Fly   366 FFDEIQRNGVGCWKTSKPISAENYGSVDSNAEDMIYPSDLSI--DEDG--TIWVMSNSMPIFIYS 426
            ....:|...:..|......|.:|...:..:.:.:.:.|.|.|  :.:|  .:||:||.:.....:
  Fly   322 ICGLVQPASLLAWNIRTGYSHQNLVMLVEDEQRLQFASGLKIVRNHEGKEELWVLSNRLQKAFGA 386

  Fly   427 TLDTSIYNFRIWK 439
            .||....||||.|
  Fly   387 GLDYKEINFRIQK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-f2NP_650247.1 MRJP 163..451 CDD:281074 75/285 (26%)
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 75/285 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449231
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.