DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f2 and regucalcin

DIOPT Version :9

Sequence 1:NP_650247.1 Gene:yellow-f2 / 41596 FlyBaseID:FBgn0038105 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_727588.2 Gene:regucalcin / 32165 FlyBaseID:FBgn0030362 Length:319 Species:Drosophila melanogaster


Alignment Length:280 Identity:57/280 - (20%)
Similarity:101/280 - (36%) Gaps:96/280 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 GMLEYPNNRQQIRRPSIWVVDLATDQVLKRFDVPES-IAET---GRGLASITVDVK------AGQ 236
            |:.|.|:  ..:.|.|::.|||....:| |:|..:: :.:|   |..||...:.|:      |..
  Fly    30 GLGEGPH--WDVARQSLYYVDLEAGSLL-RYDYAQNKVYKTKIEGETLAGFVLPVEGRPQEFAVG 91

  Fly   237 CGDAYAYI------PDL-VYRRLYVYH--LRNDRIWSFEHNYFNFDP----LSGDLS-IG----- 282
            ||.....:      |.. |.|.|:...  :..:|:     |....||    ..|.:. ||     
  Fly    92 CGRRVVIVNWDGVSPSAKVVRTLFEVQPLMEKNRL-----NDAKVDPRGRFFGGTMRYIGDEFEF 151

  Fly   283 --GQTFRWD-DGIFSITLGAQKLDGSRDAYFHPMASTNEFVVSNRVLQQESNAARSDHGNDFRVL 344
              |:.:||: .|..|:..|                   :..:||       ..|..:....|..:
  Fly   152 RHGELYRWEAGGQVSVIKG-------------------DVGISN-------GLAWDEKAKKFYYI 190

  Fly   345 GSRGPSTQSTMHAYDPGTGV-----IFFDEIQRNGVGCWKTSKPISAENYGSVDSNAEDMIYPSD 404
            .:.....:|  :.||..|||     :.|: :::|                     :.:|.:.|..
  Fly   191 DTTDYEVKS--YDYDFETGVASNPKVIFN-LRKN---------------------SPKDHLLPDG 231

  Fly   405 LSIDEDGTIWVMS-NSMPIF 423
            |:||.:|.::|.: |...|:
  Fly   232 LTIDTEGNLYVATFNGATIY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-f2NP_650247.1 MRJP 163..451 CDD:281074 57/280 (20%)
regucalcinNP_727588.2 SGL 31..290 CDD:285626 56/279 (20%)
NHL <229..302 CDD:302697 8/23 (35%)
NHL repeat 229..259 CDD:271320 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.