DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f2 and Rgn

DIOPT Version :9

Sequence 1:NP_650247.1 Gene:yellow-f2 / 41596 FlyBaseID:FBgn0038105 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_033086.1 Gene:Rgn / 19733 MGIID:108024 Length:299 Species:Mus musculus


Alignment Length:129 Identity:26/129 - (20%)
Similarity:47/129 - (36%) Gaps:39/129 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 VLQQESNAARSDHGNDFRV-------LGSRGPST--------QSTMHAYDPGTGV-IFFDEIQ-R 372
            ||.......:::..||.:|       .|:....|        |.::::..|...| .:||::. .
Mouse    89 VLAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDIS 153

  Fly   373 NGVGCW-----------KTSKPISAENY----GSVDSN------AEDMIYPSDLSIDEDGTIWV 415
            ||:. |           ..|..:.|.:|    |.:.:.      .:|...|..:.||.:|.:||
Mouse   154 NGLD-WSLDHKIFYYIDSLSYTVDAFDYDLQTGQISNRRIVYKMEKDEQIPDGMCIDAEGKLWV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-f2NP_650247.1 MRJP 163..451 CDD:281074 26/129 (20%)
RgnNP_033086.1 SGL 16..264 CDD:400653 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.