powered by:
Protein Alignment yellow-f and RGN
DIOPT Version :9
Sequence 1: | NP_524335.1 |
Gene: | yellow-f / 41595 |
FlyBaseID: | FBgn0041710 |
Length: | 429 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_004674.1 |
Gene: | RGN / 9104 |
HGNCID: | 9989 |
Length: | 299 |
Species: | Homo sapiens |
Alignment Length: | 58 |
Identity: | 17/58 - (29%) |
Similarity: | 20/58 - (34%) |
Gaps: | 21/58 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 335 YDPRTGVIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNSSEMIYPSDLTIDEEGYIWV 392
||.:||.| .|..|||....|...|..:.||.||.:||
Human 180 YDLQTGQI---------------------SNRRSVYKLEKEEQIPDGMCIDAEGKLWV 216
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
yellow-f | NP_524335.1 |
MRJP |
140..428 |
CDD:281074 |
17/58 (29%) |
RGN | NP_004674.1 |
SGL |
16..264 |
CDD:400653 |
17/58 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3386 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.