DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f and YBR053C

DIOPT Version :9

Sequence 1:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_009609.1 Gene:YBR053C / 852342 SGDID:S000000257 Length:358 Species:Saccharomyces cerevisiae


Alignment Length:269 Identity:53/269 - (19%)
Similarity:76/269 - (28%) Gaps:114/269 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SHFYNSRKCLGSSSSGSFIQYNNVPQGVTHFRGRLFVTVPRRQP--------GIPSTLNYIDLAK 112
            |.|..||...|.::|   |:|...|..:....|.:|..:.....        |....:..:|.:|
Yeast    63 SFFSISRANYGKNAS---IEYPPNPDELKESVGCIFPILDGASQNEIKQVLFGSKFGIGKLDFSK 124

  Fly   113 DGW------SQSPHL---RAYPNLAVNQYNASEQ------NLVSVYRTSVDVCGRLWFVD----- 157
            ..|      |:.|.|   ||| .|..|..|.|..      .|:|.:...::..|.|..||     
Yeast   125 SEWEYVILYSECPELSTDRAY-KLRSNDGNVSPDGKYIYVGLMSDFPFDLEPIGCLLRVDLLAHK 188

  Fly   158 --------------------------TGMLEFP--------------------NNRQQIRHP--- 173
                                      |..|.|.                    :|.|....|   
Yeast   189 IELVWNCLLIPNAIHWDESDQKTMYVTDSLNFTIWKCPGGDLLKRDELIDVKNSNNQSFESPEPD 253

  Fly   174 --SIW----------------------VIDLANDRLLKRFEIPQSIVE------IGRGLASITID 208
              :||                      :.||.|.:|||.|.:|:....      :|:.|...|.:
Yeast   254 GSAIWFSKDGKHSGFLFITVWSTSKVQMFDLTNGKLLKEFILPEQTPRVSCCCFVGKDLFVTTAN 318

  Fly   209 VGARRCNDA 217
            .   ..|||
Yeast   319 A---EINDA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 27/162 (17%)
YBR053CNP_009609.1 YvrE 1..345 CDD:225921 53/269 (20%)
WD40 repeat 150..186 CDD:293791 9/35 (26%)
WD40 repeat 199..248 CDD:293791 5/48 (10%)
WD40 repeat 259..294 CDD:293791 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.