DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f and smp-30

DIOPT Version :9

Sequence 1:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001262580.1 Gene:smp-30 / 41786 FlyBaseID:FBgn0038257 Length:306 Species:Drosophila melanogaster


Alignment Length:308 Identity:55/308 - (17%)
Similarity:111/308 - (36%) Gaps:110/308 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 TLNYIDLAKDGWSQSPHLRAYPNLAVNQYNASEQNLVSVYRTSVDVCGRLW--FVDTGMLEFPNN 166
            :|.|:||...|              :|:|: .:||  .|||..::  |.::  |:    |...|.
  Fly    30 SLYYVDLESAG--------------INRYD-FKQN--KVYRAKIE--GEIFASFI----LPVENK 71

  Fly   167 RQQIRHPSIWVIDLANDRLLKRFEIPQSIVEIGRGLASITIDVGARRCNDAYAYIPDLVNRRLHV 231
            .|:      :.:......::.:::...::.::.|.|..:..|:...|.|||              
  Fly    72 PQE------FAVGCGLRTVIVQWDGVSAVAKVTRTLFEVQPDLKENRLNDA-------------- 116

  Fly   232 YHLRSDRIWSFEHSFFNFDPLSDNLNIGGQTF-RWDDGIFSATLGSYKPDGSRDVFFHPMASTNE 295
               ::|     .:..|....::|:    |..| :|...::|...|.           .|.|..::
  Fly   117 ---KTD-----PNGRFYGGTMADS----GDIFTQWKGELYSWQAGG-----------QPNAIRSK 158

  Fly   296 FVVSNRVLQQEFNAARSDHGDDFHLLGTRGPSTQSTMHKYDPRTG------VIF-FAEVQKSGVG 353
            ..:||. |..:..|.:      |:.:.|.  :.:...:.|:..||      ||| ..:::..|  
  Fly   159 VGISNG-LAWDVKAKK------FYFIDTN--NHEVLAYDYNQSTGAVSNPKVIFDLRKIRPEG-- 212

  Fly   354 CWKTSKPFSTENHGSVYSNSSEMIYPSDLTIDEEGYIWVMS-NSMPIF 400
                                  .::|..:|:|.:|.|:|.: |...:|
  Fly   213 ----------------------PLFPDGMTVDTDGNIYVATFNGGTVF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 46/272 (17%)
smp-30NP_001262580.1 SGL 18..277 CDD:285626 55/308 (18%)
NHL 168..>248 CDD:302697 18/103 (17%)
NHL repeat 168..208 CDD:271320 9/47 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.