DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f and yellow-k

DIOPT Version :9

Sequence 1:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_648772.1 Gene:yellow-k / 39678 FlyBaseID:FBgn0036504 Length:342 Species:Drosophila melanogaster


Alignment Length:343 Identity:69/343 - (20%)
Similarity:137/343 - (39%) Gaps:88/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 HFRGRLFVTVPRRQPGIPSTLNYIDLAKDGWSQS----PHLRAYPNLAVNQYNASEQ-NLV-SVY 143
            || .|:|::|.......|:      |.:..|..|    |.: .:|::.|:.....:. :|| ..:
  Fly    43 HF-SRVFLSVNVESNDAPT------LIEAQWPVSYFPMPTV-VFPHIDVHSMGDHDDCSLVQQAH 99

  Fly   144 RTSVDVCGRLWFVDTGMLEFPNNRQQIRHPSIWVIDLA--NDRLLKRFEIPQSIVEIGRGLAS-- 204
            .:.||...|||.:|.|   ||.:...   |.::|.||.  |..||:        ::.|..:.:  
  Fly   100 WSQVDALSRLWVMDIG---FPGSTCS---PRLFVFDLMRNNAELLR--------IDCGHHIGAND 150

  Fly   205 ---ITIDVGARR--C-NDAYAY-----IP-----DLVNRRLHVYHLRSDRIWSFEHSFFNFDPLS 253
               :|:.:|.:.  | ::.:.|     :|     |::.:..|...|.|::..:...| |...|:.
  Fly   151 THFLTVQMGPKSPGCEHERHIYFILGKVPEILAYDILEQTWHRLSLESNKYENMNQS-FPIKPVD 214

  Fly   254 DNLNIGGQTFRWD-DGIFSATLGSYKPDGSRDVFFHPMASTNEFVVSNRVLQQEFNAARSDHGDD 317
            ....|.|:....| ||...:|:...:.:|..::...|:.::.:......:|    .::||...|:
  Fly   215 FIFGIQGELILSDQDGDLYSTVDRLEIEGKSELASKPINNSIKLTHLGSLL----GSSRSMIIDN 275

  Fly   318 FHLLGTRGPSTQSTMHKYDPRTGVIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNSSEMIYPSDL 382
            |           .|::...|:.|.:         |.|.|.:         ::.:..:|:||.:..
  Fly   276 F-----------GTLYYVIPKFGAV---------VRCAKLA---------NITAEGNEIIYITSK 311

  Fly   383 TIDE-----EGYIWVMSN 395
            .|.:     ...:||:|:
  Fly   312 NIQQIFFTSNDALWVLSD 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 56/283 (20%)
yellow-kNP_648772.1 MRJP 102..>201 CDD:281074 26/112 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.