DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f and yellow-g2

DIOPT Version :9

Sequence 1:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster


Alignment Length:412 Identity:89/412 - (21%)
Similarity:154/412 - (37%) Gaps:97/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RGDGYK-DLWNRICIPDSHFYNSR-----------KCLGS----SSSGSFIQYNNVPQGVTHFRG 88
            |..|.| .||.    ||....:|:           .|..:    .|||.||..|.:.........
  Fly    18 RSQGTKYGLWT----PDRAHSDSQPIQWTGGQFEFPCASTKSLFKSSGKFIPKNVIATRAQLIGD 78

  Fly    89 RLFVTVPRRQPGIPSTLNYIDLAKDGWSQSPHLRAYPNLAVNQYNASEQNLVSVYRTSVDVCGRL 153
            .:::.:||.:.|:|:||....: |.| :.|...:.||...: |...:.:.|.||....||....|
  Fly    79 TIYLALPRYRKGVPATLVKTSI-KPG-TCSTTFKPYPCWDL-QEEGNCKALQSVVDLVVDQNEVL 140

  Fly   154 WFVDTGM---LEFPNNRQQIRH--PSIWVIDLANDRLLKRFEIPQSIVEIGRGLASITIDVGARR 213
            |.:|||:   ||.|     :|.  |.:..:.:...::||...: :.:......|..:.:|.... 
  Fly   141 WVLDTGIVNTLETP-----VRKCPPKVVAMSVKTGKVLKTVSL-EGLTSSNSRLQYLVVDYAPD- 198

  Fly   214 CNDAYAYIPDLVNRRLHVYHLRSDRIWSFEHSFFNFDPLSDNLNIGGQTFRWDDGIFSATLGSYK 278
             ...:.|:.|..||.:.||:|::||         .|..:.......|...|  |.::.|.:  .:
  Fly   199 -GGCFVYVSDAANRAIIVYNLQADR---------GFRVVLPKAVTAGCRSR--DVLYIALI--RR 249

  Fly   279 PDGSRDVFFHPMASTNEF-----------VVSNRVLQQEFNAARSDHGDDFHLLGTRGPSTQSTM 332
            ..||.:::| ...|||:.           |...|:|......:|      ..::||...|     
  Fly   250 DCGSTELYF-TYLSTNKLFSLKSEYLRSGVADGRILDLGKKPSR------MVIIGTDNGS----- 302

  Fly   333 HKYDPRTGVIFFAEVQKSGVGCWKTSKPFSTENHGSVY-SNSSEMIYPSDLTIDEEGYIWVMSNS 396
                    .|||.....:.|..|.|:..|...|...|| |.:.:::                :::
  Fly   303 --------AIFFRNEGDAEVYRWDTNSTFVEANFKPVYRSQTCQLV----------------THA 343

  Fly   397 MPIFVYSKLDVEKYNFRIWRQS 418
            :|.:..:.:.|.:.||..:.|:
  Fly   344 VPDYKRNTMRVLQSNFPDYMQN 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 61/296 (21%)
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 61/296 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.