DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f and yellow-d2

DIOPT Version :9

Sequence 1:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster


Alignment Length:338 Identity:91/338 - (26%)
Similarity:168/338 - (49%) Gaps:26/338 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LFVTVPRRQPGIPSTLNYI--DLAKDGWSQSPHLRAYPNLAVNQYNASEQN-LVSVYRTSVDVCG 151
            :|||:||...|:|.:|.|:  ::..:|    ..|:|||:...::.:.::.| |.|||||.:|.||
  Fly    73 IFVTIPRFAKGVPYSLAYVTNEMRPNG----TLLQAYPSYEWHKSHGADCNGLTSVYRTQIDECG 133

  Fly   152 RLWFVDTGMLEFPNNRQQIRH--PSIWVIDLANDRLLKRFEIPQSIVEIG-RGLASITIDVGARR 213
            |:|.:|:|.::|      |:|  |.::.|||.:.::..::::|:.:.:.| ....:.|:::....
  Fly   134 RMWILDSGEIDF------IQHCPPQLYAIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVELDPHN 192

  Fly   214 CNDAYAYIPDLVNRRLHVYHLRSDRIWSFEHSFFNFDPLSDNLNIGGQTFRWDDGIFSATLGSYK 278
            |:..:.|:.|.:...:.||.:.:.:.|..|:.|....|......|.|::|:..||..|.||..:.
  Fly   193 CDVGFVYMADSIGDGIVVYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHG 257

  Fly   279 PDGSRDVFFHPMASTNEFVVSNRVLQQEFNAARSDHG---DDFHLLGTRGPSTQSTMHKYDPRTG 340
            ..|.|.::||.::|..:..:...|:....|...:|..   |.|.|||.||....:....   .:|
  Fly   258 LGGRRMMYFHSLSSEWQMAIPLDVVNNGSNWRLNDVSAALDQFQLLGKRGSQCVAAAMS---ESG 319

  Fly   341 VIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNSSEMIYPSDLTI--DEEG--YIWVMSNSMPIFV 401
            .:....||.:.:..|.....:|.:|...:..:...:.:.|.|.|  :.||  .:||:||.:....
  Fly   320 FLICGLVQPASLLAWNIRTGYSHQNLVMLVEDEQRLQFASGLKIVRNHEGKEELWVLSNRLQKAF 384

  Fly   402 YSKLDVEKYNFRI 414
            .:.||.::.||||
  Fly   385 GAGLDYKEINFRI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 75/285 (26%)
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 75/285 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449227
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.