DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f and yellow-b

DIOPT Version :9

Sequence 1:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster


Alignment Length:430 Identity:141/430 - (32%)
Similarity:224/430 - (52%) Gaps:36/430 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDVLLLCAISGFQLLISADGDPMIEVFKWKQLDF-YNRGDGYKDLWNRICIPDSHFYNSRKCLGS 67
            |.:|||.|:|...      .|.:...::|:::|| |...|   ..|:.|                
  Fly     6 LGLLLLWAVSALA------NDNLRVAYEWREMDFKYANPD---QRWSAI---------------- 45

  Fly    68 SSSGSFIQYNNVPQGVTHFRGRLFVTVPRRQPGIPSTLNYIDLAKDGWSQSPHLRAYPNLAVNQY 132
             ..|.|...|.:|.|:.....|||||:||.:.|:|::|.|:|| .|..|:.|.|:.:|:...:..
  Fly    46 -ERGEFKPANVIPFGLEVAGHRLFVTLPRWRDGVPASLAYLDL-NDTSSKGPALKPFPSWQAHNL 108

  Fly   133 NASEQNLVSVYRTSVDVCGRLWFVD---TGMLEFPNNRQQIRHPSIWVIDLANDRLLKRFEIPQS 194
            ..:|..|||.:|...|.|||||.:|   :|:||   ..:......:.|.||.||.||:|..:|..
  Fly   109 QEAEPELVSPFRVRADRCGRLWVLDSRISGVLE---QTKIYGAAQLLVYDLHNDDLLRRHVLPAG 170

  Fly   195 IVEIGRGLASITIDVGARRCNDAYAYIPDLVNRRLHVYHLRSDRIWSFEHSFFNFDPLSDNLNIG 259
            .::.|..||::.::  ...|.:.:||..||.:..|.||..:.:..|..:|.||:.||::.|.:|.
  Fly   171 QLKQGSLLANLAVE--DSDCENTFAYAADLGSPGLVVYSWKDEESWRVQHHFFHPDPMAGNFSIN 233

  Fly   260 GQTFRWDDGIFSATLGSYKPDGSRDVFFHPMASTNEFVVSNRVLQQEFNAARSDHGDDFHLLGTR 324
            |..|:||||::...|......|...::|||:.||.||.|...:|:.:..|.......:|.:||:|
  Fly   234 GIEFQWDDGLYGLALSKPLETGYATLYFHPLCSTTEFSVDTSILRNKTLATSPMIYREFKVLGSR 298

  Fly   325 GPSTQSTMHKYDPRTGVIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNSSEMIYPSDLTIDEEGY 389
            ||:||:.....||.|||:|:|....:.|.||:|:..||..:...::.|:..:::|||:.:|::..
  Fly   299 GPNTQAGAEFLDPDTGVLFYALPNLNEVACWRTATDFSHSSQSRIHMNNDTLVFPSDIKVDDQKR 363

  Fly   390 IWVMSNSMPIFVYSKLDVEKYNFRIWRQSTLLAKRGTVCE 429
            :||:||.:|:|:|.:|.....||||...|...|...|.||
  Fly   364 LWVLSNQLPVFIYDELYAGSINFRILTASVKEAIENTACE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 100/290 (34%)
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 100/290 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449200
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.