DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f and y

DIOPT Version :9

Sequence 1:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_476792.1 Gene:y / 30980 FlyBaseID:FBgn0004034 Length:541 Species:Drosophila melanogaster


Alignment Length:404 Identity:143/404 - (35%)
Similarity:213/404 - (52%) Gaps:26/404 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EVFKWKQLDFYNRGDGYKDLWNRICIPDSHFYNSRKCLGSSSSGSFIQYNNVPQGVTHFRGRLFV 92
            |.:.|.||||                   .|.|:|....:.:||.:|..|.:|.||.||..||||
  Fly    27 ERYSWSQLDF-------------------AFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFV 72

  Fly    93 TVPRRQPGIPSTLNYIDLAKDGWSQSPHLRAYPNLAVNQYNASEQNLVSVYRTSVDVCGRLWFVD 157
            ||||.:.|||:||.||::.: ..:.||.|..||:...|.......::.:.||..||.|||||.:|
  Fly    73 TVPRWRDGIPATLTYINMDR-SLTGSPELIPYPDWRSNTAGDCANSITTAYRIKVDECGRLWVLD 136

  Fly   158 TGMLEFPNNRQQIRHPSIWVIDLANDRLLKRFEIPQSIVEIGRGLASITIDVGARRCNDAYAYIP 222
            ||.:...|........::.|.||..|..::|:|:|.........:|:|.:|:| :.|:|||||..
  Fly   137 TGTVGIGNTTTNPCPYAVNVFDLTTDTRIRRYELPGVDTNPNTFIANIAVDIG-KNCDDAYAYFA 200

  Fly   223 DLVNRRLHVYHLRSDRIWSFE-HSFFNFDPLSDNLNIGGQTFRW-DDGIFSATLGSYKPDGSRDV 285
            |.:...|..|....::.|.|. ||:|..|||..:.|:.|..|:| ::|||..:|...:.||.|.:
  Fly   201 DELGYGLIAYSWELNKSWRFSAHSYFFPDPLRGDFNVAGINFQWGEEGIFGMSLSPIRSDGYRTL 265

  Fly   286 FFHPMASTNEFVVSNRVLQQEFNAARSDHGDDFHLLGTRGPSTQSTMHKYDPRTGVIFFAEVQKS 350
            :|.|:||..:|.||.|:|:.|.....|.|  ||..|..|||::.:|...... .|:..|..:.::
  Fly   266 YFSPLASHRQFAVSTRILRDETRTEDSYH--DFVALDERGPNSHTTSRVMSD-DGIELFNLIDQN 327

  Fly   351 GVGCWKTSKPFSTENHGSVYSNSSEMIYPSDLTIDEEGYIWVMSNSMPIFVYSKLDVEKYNFRIW 415
            .||||.:|.|:|.:.||.|..:...:::|:|:.|||...:||:|:.||:|:.|.||....||||:
  Fly   328 AVGCWHSSMPYSPQFHGIVDRDDVGLVFPADVKIDENKNVWVLSDRMPVFLLSDLDYSDTNFRIY 392

  Fly   416 RQSTLLAKRGTVCE 429
            ..........|||:
  Fly   393 TAPLATLIENTVCD 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 102/289 (35%)
yNP_476792.1 MRJP 119..405 CDD:308585 102/289 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449206
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.