powered by:
Protein Alignment yellow-f and Rgn
DIOPT Version :9
Sequence 1: | NP_524335.1 |
Gene: | yellow-f / 41595 |
FlyBaseID: | FBgn0041710 |
Length: | 429 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_033086.1 |
Gene: | Rgn / 19733 |
MGIID: | 108024 |
Length: | 299 |
Species: | Mus musculus |
Alignment Length: | 58 |
Identity: | 15/58 - (25%) |
Similarity: | 19/58 - (32%) |
Gaps: | 21/58 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 335 YDPRTGVIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNSSEMIYPSDLTIDEEGYIWV 392
||.:||.| .|...||....:...|..:.||.||.:||
Mouse 180 YDLQTGQI---------------------SNRRIVYKMEKDEQIPDGMCIDAEGKLWV 216
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
yellow-f | NP_524335.1 |
MRJP |
140..428 |
CDD:281074 |
15/58 (26%) |
Rgn | NP_033086.1 |
SGL |
16..264 |
CDD:400653 |
15/58 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3386 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.