DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-f and Rgn

DIOPT Version :10

Sequence 1:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_033086.1 Gene:Rgn / 19733 MGIID:108024 Length:299 Species:Mus musculus


Alignment Length:58 Identity:15/58 - (25%)
Similarity:19/58 - (32%) Gaps:21/58 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 YDPRTGVIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNSSEMIYPSDLTIDEEGYIWV 392
            ||.:||.|                     .|...||....:...|..:.||.||.:||
Mouse   180 YDLQTGQI---------------------SNRRIVYKMEKDEQIPDGMCIDAEGKLWV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-fNP_524335.1 MRJP 140..428 CDD:308585 15/58 (26%)
RgnNP_033086.1 SGL 16..264 CDD:462480 15/58 (26%)

Return to query results.
Submit another query.