DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31342 and SDCBP

DIOPT Version :9

Sequence 1:NP_001097763.1 Gene:CG31342 / 41592 FlyBaseID:FBgn0051342 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_001335270.1 Gene:SDCBP / 6386 HGNCID:10662 Length:319 Species:Homo sapiens


Alignment Length:357 Identity:84/357 - (23%)
Similarity:149/357 - (41%) Gaps:77/357 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   655 SRRDFHYLKLLNTPLKTKTSHKSTS--AANNNIEQSTPSSSNSTQVTPTQRNNTSIVTGDSQEQR 717
            :.||.|.:.::..|.| .:.:.|..  ..:..|:..|..|:|..        |.:|:        
Human     6 TNRDLHIIVMVKNPAK-MSLYPSLEDLKVDKVIQAQTAFSANPA--------NPAIL-------- 53

  Fly   718 RRSSSTSDAQAPL--------QRVPQPATQRNANNNEFTPSRNGAFRMQPPPQG---TPPSSTN- 770
                  |:|.||:        :..|:.:.....:.||.....|.|.....|.||   ..|||.| 
Human    54 ------SEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINY 112

  Fly   771 -PAQQSPNKRLTLREQQVMQLRREIM----HPGGVRLNLRRKDCVGSIAWVEAFGGVWIAGWKQK 830
             .|..:.|. :.:|..::.|..||::    ..|.:.|.|:..|           .|:::. ..|.
Human   113 MVAPVTGND-VGIRRAEIKQGIREVILCKDQDGKIGLRLKSID-----------NGIFVQ-LVQA 164

  Fly   831 EHPVLYNALHIGDQLLSIAGVSIS--SAAEANKIIRNTNTLFVEVLLRRIPFGRAYAIRRDREGQ 893
            ..|.....|..|||:|.|.|.:.:  |:.:|:|:::......:.:.:|..||.|...:.:|..|.
Human   165 NSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGH 229

  Fly   894 CLGLIRDGNTSTIVDVVPNSLAARHGLPPKTQSCDGNSLTFWMLTEINGRSLNLFFKDFEIRDRL 958
            ...:.::|.   |..:|.:|.|||:||           ||...:.||||::: :..||.:|.|.|
Human   230 VGFIFKNGK---ITSIVKDSSAARNGL-----------LTEHNICEINGQNV-IGLKDSQIADIL 279

  Fly   959 NSVGRDISILVQPSDLITKLKKQ-----LKSL 985
            ::.|..::|.:.|:.:...:.|:     :|||
Human   280 STSGTVVTITIMPAFIFEHIIKRMAPSIMKSL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31342NP_001097763.1 PDZ 886..973 CDD:214570 25/86 (29%)
SDCBPNP_001335270.1 PDZ_signaling 133..212 CDD:238492 19/90 (21%)
PDZ_signaling 217..290 CDD:238492 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12345
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4935
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.