DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31342 and sdcbp

DIOPT Version :9

Sequence 1:NP_001097763.1 Gene:CG31342 / 41592 FlyBaseID:FBgn0051342 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_001006801.1 Gene:sdcbp / 448508 XenbaseID:XB-GENE-953662 Length:295 Species:Xenopus tropicalis


Alignment Length:380 Identity:79/380 - (20%)
Similarity:135/380 - (35%) Gaps:121/380 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   625 TAQPVTP---NAAGRATPQLTRGLTELVISSRPSRRDFHYLKLLNTPLKTKTSHKSTSAANNNIE 686
            :|.||.|   .||..:.||......:|.    |....:..|.|....:     ||:.|.      
 Frog    23 SANPVNPAILPAASASAPQYGGMYPKLY----PELEQYMGLSLSEDEI-----HKNMSL------ 72

  Fly   687 QSTPSSSNSTQVTPTQRNNTSIVTGDSQEQRRRSSSTSDAQAPLQRVPQPATQRNANNNEFTPSR 751
              .||..|...: ||..||                                              
 Frog    73 --VPSGGNQVAI-PTALNN---------------------------------------------- 88

  Fly   752 NGAFRMQPPPQGTPPSSTNPAQQSPNKRLTLREQQVMQLRREIM----HPGGVRLNLRRKDCVGS 812
                 |..|..|..              :.:|..::.|..||.:    ..|.:.|.|:..|    
 Frog    89 -----MVAPVSGND--------------VGIRRAEIKQGIREAILCKDQDGKIGLRLKSID---- 130

  Fly   813 IAWVEAFGGVWIAGWKQKEHPVLYNALHIGDQLLSIAGVSIS--SAAEANKIIRNTNTLFVEVLL 875
                   .|:::. ..|...|.....|..|||:|.|.|.:.:  |:.:::||::..:...:.:::
 Frog   131 -------NGIFVQ-LVQTNSPASLAGLKFGDQILQINGENCAGWSSDKSHKILKQVSGERISMIV 187

  Fly   876 RRIPFGRAYAIRRDREGQCLGLIRDGNTSTIVDVVPNSLAARHGLPPKTQSCDGNSLTFWMLTEI 940
            |..||.|...:.:|..|....:.::|.   |..:|.:|.|||:||           ||...|.||
 Frog   188 RDRPFERTITMHKDSTGHVGFIFKNGK---ITSIVKDSSAARNGL-----------LTDHNLCEI 238

  Fly   941 NGRSLNLFFKDFEIRDRLNSVGRDISILVQPSDLITKLKKQLKS--LRGYKDYLV 993
            ||::: :..||.::.:.|.:....:::.|.||.:...:.|::.|  |:...|:.|
 Frog   239 NGQNV-IGLKDSQVAELLATSANVVTLTVMPSYIFEHMVKRMASSVLKNLMDHSV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31342NP_001097763.1 PDZ 886..973 CDD:214570 23/86 (27%)
sdcbpNP_001006801.1 PDZ 120..188 CDD:238080 17/79 (22%)
PDZ_signaling 193..266 CDD:238492 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48002
Panther 1 1.100 - - O PTHR12345
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4935
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.