DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31342 and Sdcbp2

DIOPT Version :9

Sequence 1:NP_001097763.1 Gene:CG31342 / 41592 FlyBaseID:FBgn0051342 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_001020863.1 Gene:Sdcbp2 / 311532 RGDID:1307709 Length:296 Species:Rattus norvegicus


Alignment Length:273 Identity:68/273 - (24%)
Similarity:111/273 - (40%) Gaps:57/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   720 SSSTSDAQAPLQRVPQPATQRNANNNEFTPSRNGAFRMQPPPQGTPPSSTNP-----AQQSPNKR 779
            |.|:.:.|..|.::|.              ..|.......|.|.|.|.|.|.     |:..|.  
  Rat    61 SLSSQEVQKNLSQIPD--------------GDNMVITSPGPGQVTAPVSGNDLGVLRAEIKPG-- 109

  Fly   780 LTLREQQVMQLRREIMHPGGVRLNLRRKDCVGSIAWVEAFGGVWIAGWKQKEHPVLYNALHIGDQ 844
              :||   :.|.::.....|:||....|             |:::. ..|...|.....|..|||
  Rat   110 --VRE---IHLCKDERGKTGLRLQAVDK-------------GLFVQ-LVQANTPASLVGLRFGDQ 155

  Fly   845 LLSIAGVSIS--SAAEANKIIRNTNTLFVEVLLRRIPFGRAYAIRRDREGQCLGLIRDGNTSTIV 907
            :|.|.|...:  |..:|.|.::..:...:.:::|..||.|...:.:|..||....|:.|.   ||
  Rat   156 ILQIDGCDCAGWSTHKAQKALKKASAEKIVMVVRDRPFQRTVTMHKDSSGQVGFFIKKGK---IV 217

  Fly   908 DVVPNSLAARHGLPPKTQSCDGNSLTFWMLTEINGRSLNLFFKDFEIRDRLNSVGRDISILVQPS 972
            .||..|.|||:||           ||...:.|:||::: :..||.:|.:.|.:.|..|::.:.|:
  Rat   218 SVVKGSSAARNGL-----------LTNHYVCEVNGQNV-IGLKDKKIIEILTTAGNVITLTIIPT 270

  Fly   973 DLITKLKKQLKSL 985
            .:...:.|:|..|
  Rat   271 VIYEHMIKKLSPL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31342NP_001097763.1 PDZ 886..973 CDD:214570 27/86 (31%)
Sdcbp2NP_001020863.1 PDZ_signaling 110..189 CDD:238492 20/95 (21%)
PDZ_signaling 195..268 CDD:238492 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12345
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.