DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31342 and SDCBP2

DIOPT Version :9

Sequence 1:NP_001097763.1 Gene:CG31342 / 41592 FlyBaseID:FBgn0051342 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_001186713.1 Gene:SDCBP2 / 27111 HGNCID:15756 Length:292 Species:Homo sapiens


Alignment Length:233 Identity:61/233 - (26%)
Similarity:105/233 - (45%) Gaps:38/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 PQG--TPPSSTNPAQQ-SP--NKRLTLREQQVMQLRREIM----HPGGVRLNLRRKDCVGSIAWV 816
            |:|  |..|...|.|. :|  ...|.:|..::....|||.    ..|...|.||:.|        
Human    71 PEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVD-------- 127

  Fly   817 EAFGGVWIAGWKQKEHPVLYNALHIGDQLLSIAGVSIS--SAAEANKIIRNTNTLFVEVLLRRIP 879
               .|:::. ..|...|.....|..|||||.|.|...:  |:.:|:::::..:...:.|::|..|
Human   128 ---QGLFVQ-LVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRP 188

  Fly   880 FGRAYAIRRDREGQCLGLIRDGNTSTIVDVVPNSLAARHGLPPKTQSCDGNSLTFWMLTEINGRS 944
            |.|...:.:|..|....:|:.|.   ||.:|..|.|||:||           ||...:.|::|::
Human   189 FQRTVTMHKDSMGHVGFVIKKGK---IVSLVKGSSAARNGL-----------LTNHYVCEVDGQN 239

  Fly   945 LNLFFKDFEIRDRLNSVGRDISILVQPSDLITKLKKQL 982
            : :..||.:|.:.|.:.|..:::.:.||.:...:.|:|
Human   240 V-IGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31342NP_001097763.1 PDZ 886..973 CDD:214570 23/86 (27%)
SDCBP2NP_001186713.1 PDZ 117..185 CDD:238080 19/79 (24%)
PDZ_signaling 191..264 CDD:238492 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12345
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4935
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.