DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paip2 and Paip2

DIOPT Version :10

Sequence 1:NP_524334.1 Gene:Paip2 / 41591 FlyBaseID:FBgn0038100 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_080696.1 Gene:Paip2 / 67869 MGIID:1915119 Length:124 Species:Mus musculus


Alignment Length:125 Identity:49/125 - (39%)
Similarity:69/125 - (55%) Gaps:18/125 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKVPSVDWTDQIIYVVDDDESLSDIDDEPD--FSEYMWMENEEEFDKNELQRLEEEEIMQECFEA 65
            :|.||...|...|  ::||..::....|.|  |:|||||||||||::...:.|.|||.::.||:.
Mouse     1 MKDPSRSSTSPSI--INDDVIINGHSHEEDNPFAEYMWMENEEEFNRQIEEELWEEEFIERCFQE 63

  Fly    66 MIEDELEEQINEW-----EKAKT-----DEQNTALSALPKSQCD-VEKSVLNPMADEFVP 114
            |:|   ||:.:||     :..:|     |:.|..:.:...|..| |.||.|||.|.||||
Mouse    64 MLE---EEEEHEWFIPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNAKEFVP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paip2NP_524334.1 PAM2 101..117 CDD:429316 10/14 (71%)
Paip2NP_080696.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 7/22 (32%)
PABPC1-interacting motif-1 (PAM1). /evidence=ECO:0000250 22..75 24/54 (44%)
PABPC1-interacting motif-2 (PAM2). /evidence=ECO:0000250 105..120 6/8 (75%)
PAM2 108..123 CDD:429316 4/5 (80%)

Return to query results.
Submit another query.