DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paip2 and PAIP2

DIOPT Version :9

Sequence 1:NP_001262515.1 Gene:Paip2 / 41591 FlyBaseID:FBgn0038100 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001028284.1 Gene:PAIP2 / 51247 HGNCID:17970 Length:127 Species:Homo sapiens


Alignment Length:126 Identity:50/126 - (39%)
Similarity:70/126 - (55%) Gaps:20/126 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKVPSVDWTDQIIYVVDDDESL---SDIDDEPDFSEYMWMENEEEFDKNELQRLEEEEIMQECFE 64
            :|.||...|...|  :::|..:   |..||.| |:|||||||||||::...:.|.|||.::.||:
Human     1 MKDPSRSSTSPSI--INEDVIINGHSHEDDNP-FAEYMWMENEEEFNRQIEEELWEEEFIERCFQ 62

  Fly    65 AMIEDELEEQINEW-----EKAKT-----DEQNTALSALPKSQCD-VEKSVLNPMADEFVP 114
            .|:|   ||:.:||     :..:|     |:.|..:.:...|..| |.||.|||.|.||||
Human    63 EMLE---EEEEHEWFIPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNAKEFVP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paip2NP_001262515.1 PAM2 102..117 CDD:399847 10/13 (77%)
PAIP2NP_001028284.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 6/24 (25%)
PABPC1-interacting motif-1 (PAM1) 22..75 28/56 (50%)
PABPC1-interacting motif-2 (PAM2) 105..120 9/14 (64%)
PAM2 108..123 CDD:284542 10/13 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5392
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51398
OrthoDB 1 1.010 - - D1624094at2759
OrthoFinder 1 1.000 - - FOG0004724
OrthoInspector 1 1.000 - - otm41632
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3889
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.