DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paip2 and paip2b

DIOPT Version :9

Sequence 1:NP_001262515.1 Gene:Paip2 / 41591 FlyBaseID:FBgn0038100 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_957060.1 Gene:paip2b / 393739 ZFINID:ZDB-GENE-040426-1736 Length:131 Species:Danio rerio


Alignment Length:107 Identity:40/107 - (37%)
Similarity:58/107 - (54%) Gaps:17/107 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DESLSDIDDEPD---FSEYMWMENEEEFDKNELQRLEEEEIMQECFEAMIEDELEEQINEWEKAK 82
            ||::.:...|.|   |:||||||||||:::...:.|.|:|.::.||:.|    |||:..:|....
Zfish    25 DENVVNGRKEGDANPFAEYMWMENEEEYNRQVEEELLEQEFLERCFQEM----LEEEDQDWFIPA 85

  Fly    83 TD---------EQNTALSALPKSQCDV-EKSVLNPMADEFVP 114
            .|         :|.:.||....:..|: .||.|||.|.||||
Zfish    86 RDLPSGVGQIQQQLSGLSVSDGNAEDIARKSSLNPEAKEFVP 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paip2NP_001262515.1 PAM2 102..117 CDD:399847 10/13 (77%)
paip2bNP_957060.1 PAM2 113..130 CDD:284542 10/15 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5393
OMA 1 1.010 - - QHG51398
OrthoDB 1 1.010 - - D1624094at2759
OrthoFinder 1 1.000 - - FOG0004724
OrthoInspector 1 1.000 - - oto41758
orthoMCL 1 0.900 - - OOG6_110722
Panther 1 1.100 - - LDO PTHR13154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5420
SonicParanoid 1 1.000 - - X3889
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.